KEGG   Leuconostoc garlicum: A9176_00480
Entry
A9176_00480       CDS       T04802                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00052  Galactose metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
Module
lgc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_00480
   00052 Galactose metabolism
    A9176_00480
Enzymes [BR:lgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A9176_00480
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: AQN78965
LinkDB
Position
complement(103416..104450)
AA seq 344 aa
MEILTQPFGAQAISYTLINDHGVALSVTDFGARIVSLRVPLATGERELVLGFDSAEEYQQ
KDTFIGATIGRVAGRIAGAHWAHDGVDYQFEANENDNTLHSGVIGFDQRYWQAAPQVTAT
EARVVFTYVSEDGENGFPGQVTVNVTYALANDNVWRLTYEAVTDTPTLFNPTNHVYFNLT
GDPSQSVAAHQLKIAADTFAPIGDKNLTTGEIRSVAGTSFDFRAAKPVGTTIESTDDQHQ
RVGHGLDHPFLLQDTQGAPQAELLSPDGLVGVAMTTTAPAVVVFTGNFGTDFTLPMRQSQ
LKNHGGITLETQAVPGAERFAQYGDIVLTPASPYQQVTEFKLDF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaaattttaacccaaccgtttggtgcacaagcaataagctacaccttaatcaacgat
catggcgtggccttaagtgtaacggattttggcgcacgaattgtgagtttgcgcgtgcca
cttgcgactggtgaacgtgaattggtattaggttttgatagtgcggaagaatatcaacaa
aaagatacctttattggggccacaattggccgtgttgctggtcgaattgctggggcacat
tgggcacacgatggtgtcgattaccagtttgaagccaatgaaaatgacaacaccttacac
agtggtgtgattggttttgaccaacgctactggcaagctgcaccacaggtgacggcaaca
gaggcaagggttgtgtttacttatgtcagtgaagacggggaaaatggttttcctggtcaa
gtgacggtaaacgtgacctatgctttggctaatgataacgtctggcggttaacgtatgag
gctgtgacagatacgccaacactctttaacccaacgaaccatgtctactttaacttgacg
ggtgacccatcgcaaagtgttgcagcacatcaacttaagattgcggctgatacctttgcg
ccaattggtgacaagaatttaacgactggggaaatacggtcagtagctgggacaagtttt
gattttcgtgcggcaaaaccagttggtacgacgattgagagtaccgatgaccaacatcaa
cgggttggtcatgggcttgatcatccatttttgctacaagatacacagggggcaccgcaa
gctgaactgctatcaccagatggtttggtgggcgttgccatgaccacgacggcaccggca
gtagtggtctttacgggtaattttggtacagatttcacgctgccaatgcgccaatcacag
ttgaaaaaccatggcggtattacgctagagacgcaagcagtacctggcgctgaacgtttt
gcgcaatacggagatattgtcctcacgccggcatcaccttatcagcaagttaccgaattt
aagctggacttttaa

KEGG   Leuconostoc garlicum: A9176_05735
Entry
A9176_05735       CDS       T04802                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00052  Galactose metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
Module
lgc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_05735
   00052 Galactose metabolism
    A9176_05735
Enzymes [BR:lgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A9176_05735
SSDB
Motif
Pfam: Aldose_epim PTSIIA_gutA
Other DBs
NCBI-ProteinID: AQN79877
LinkDB
Position
1129789..1130757
AA seq 322 aa
MQVKEQVFGHLPDGQEVTAYTLVNDNQTAVTALTYGATWQSFRVIKAGQSHELLVNFDQL
SDYVGQPFHVGHTIGPVGGRLSQVAYQFDGEAFKLTPNDGPNILHSGINGFDRVNWQASV
TQDTHQVAVHFTHTFVTEFPGELRAEVTYTLDEADRVTITFSGQSTATTLFNPMTHVYFN
FDGRQQDASQHELQIAAREHVAVDDAKIPTGILVENTGTKFDLEALKPIGDTRFDDAWRL
ADDRQGPAVILRSPKTGVALAIDSDRNGVVVFTTNPAMDSDQMTAVAIEMQTLPDAVNHP
DFGDIVLPANVKKTYQVTYDLI
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcaagtaaaagagcaggtatttggccatttaccagatggtcaagaagtaacggcgtac
acgttagtcaatgataatcaaacagcggtgaccgctttgacctatggcgcgacttggcaa
tcatttcgcgtgattaaagctggtcaatcacatgaactactggttaattttgatcagctg
tctgactatgtgggacaacctttccacgtggggcatacaatcggtccagtgggtggtcgc
ttatcgcaagtggcctatcaatttgacggtgaagcgttcaaattaacaccgaatgatggc
ccaaacattttgcactcaggtattaatgggtttgatcgcgtgaattggcaagcatccgtg
acgcaagatacccaccaagtagcggtgcattttactcacacgtttgtgacagaatttccc
ggcgaattgcgggcagaagtaacgtatacactggatgaggctgatcgtgtgacgatcaca
ttcagtgggcaatcaacggcaacgacattattcaatccgatgacccatgtttatttcaac
tttgatgggcgacagcaagatgcgagccagcatgaattacaaattgctgcgcgtgagcat
gtggcagttgatgacgctaaaatcccaactggaatactggttgaaaacactgggactaaa
tttgacctcgaagcgttaaaaccaattggtgacacccgctttgatgatgcttggcgcttg
gctgatgatcggcaagggccggcagtgatcttacgctcgcccaagactggtgtggcgctt
gccattgattcagatcgtaacggggtggtggtctttacgaccaatccagcgatggatagt
gatcagatgacagccgttgcgattgaaatgcaaaccttacctgacgcggttaatcatcca
gactttggggatattgtgttaccggcaaatgtgaagaaaacctatcaagtgacttatgat
ttaatttaa

DBGET integrated database retrieval system