KEGG   Leuconostoc garlicum: A9176_00485
Entry
A9176_00485       CDS       T04802                                 

Definition
(GenBank) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
Module
lgc_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
lgc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_00485
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_00485
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     A9176_00485
SSDB
Motif
Pfam: GalP_UDP_transf GalP_UDP_tr_C
Other DBs
NCBI-ProteinID: AQN78966
LinkDB
Position
complement(104472..105992)
AA seq 506 aa
MNRNGLITVFVQRIIAATDYTELDETYLINQVLGWLGEADYQTPTTLTPWEDTDTLTLLD
ALIRVADTNGTLARREMNADMVGAQLMALFVPRPSEVNRIFWEKYASEPAAATDYLFALS
RRSNYIKTREIGQNISFPVTTKYGALQITINLSKPEKDPKMIAAALQAQKNTPVNYPVSQ
LSHDNEGYWGRLDYPARANHRVVALTLGGEPWFFQYSPYAYFNEHAIIFSKTIRPMRVDV
AHLAKLLEFVTLFPDYFIGSNADLPIVGGSILTHDHFQAGRYDLPMAQATIKTPITLPGC
QVASAGVLNWPMTVIRLADENQANLLQAAQQIMTTWAHYSDPALDIRAFDAQGERHHTVT
PIARYRDGRYELDLVLRDNNVSETYPDGIFHPHADVQHIKQENIGLIEVMGLAILPPRLK
TELEVVKAYLLGQVDQVAPKHQLWAETLRANTTITPENVNAIIDDSVGHIFERVLEDAGV
YKHDAVGEAGLARFLQAVAQNVQVSD
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaatcgaaatggcttaatcacggtctttgtccagcggattattgcggcaacagactat
accgaactagatgagacctatttaattaatcaggtactgggctggcttggggaagcagac
tatcaaacaccaaccacattgaccccttgggaagatacggacaccttaaccttgttggat
gcgttaattcgtgtggccgacacgaacgggacattggcgcgtcgtgagatgaacgcggat
atggtcggtgcccaattgatggccctctttgtcccacgaccttctgaggtgaaccggatt
ttttgggaaaaatatgctagtgaacccgctgctgctacggactacttatttgccttatca
cgccgcagtaactacattaagacacgtgaaattggtcaaaatatctcgtttccggtcacg
acaaaatatggggcgttacaaatcacgataaatttgtcgaaaccagaaaaagatcccaag
atgattgcagcagcgttgcaggctcaaaaaaatacgcccgtcaattatccagtgtcgcaa
ttatcccatgataatgaaggctactgggggcgactagattatccagcacgggcaaatcat
cgggtggtggcgttgacgttgggtggggaaccttggtttttccaatattcaccgtatgcc
tattttaatgaacacgcaattatcttttcaaaaacgattcgaccaatgcgtgtcgatgtg
gcgcatttggcaaaattattagaatttgtcacgttatttccggattattttatcgggtcc
aatgcggacttgcccattgtcggtggctctattctaacgcatgatcatttccaggcggga
cgctacgacttaccaatggctcaggctaccattaagacgccaatcacgctgccggggtgt
caagttgcgtcagctggggtgttaaattggccgatgacggtgattcgtttggccgatgaa
aaccaagccaacttgctacaagctgcccaacaaattatgacgacttgggcgcattatagt
gatcctgcgttagacattcgtgcttttgatgcgcagggcgaacggcatcataccgtaacg
cccattgcgcgctatcgtgacggacgctacgaacttgatttagtgttgcgggataataac
gtatcggagacgtatcctgatggtattttccatccccacgccgatgtccaacatattaaa
caagaaaatattggtttaattgaggtcatgggcttggcgatcttaccaccaaggttaaag
accgaacttgaggttgttaaggcctacttattaggccaagttgaccaggtggcaccaaag
catcaattgtgggctgaaacattgcgtgccaacaccaccattacacccgaaaatgtcaac
gctatcattgatgacagtgtcggacacatttttgagcgggtcttagaagatgcgggtgtc
tataaacatgacgctgtcggagaagctggtttggcgcgtttcctgcaggctgtggcccaa
aatgtacaagtatcagattaa

DBGET integrated database retrieval system