KEGG   Leuconostoc garlicum: A9176_00490
Entry
A9176_00490       CDS       T04802                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
Module
lgc_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
lgc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_00490
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_00490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgc04147]
    A9176_00490
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     A9176_00490
Exosome [BR:lgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9176_00490
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N DUF3802
Other DBs
NCBI-ProteinID: AQN78967
LinkDB
Position
complement(106002..107180)
AA seq 392 aa
MTTIYDELANVYHTQFQTQPTDKFFSPGRINLIGEHTDYNGGHVFPAAITLGTYGVAGKR
TDKLVKLYSTNMPEAGVITFEIDDESKLPHGSWGNFVKGVLQALRGYGNQFETGFELVIS
GNIPNGSGLSSSSSLELLIGVVAKKLYDLKVPRLQLVASGQRAENDFVGVNTGIMDQFAI
GFGEEDHAIYLDTNTMIYEMIPTHLGDHVIVIMNTNKRRELADSKYNERVRETQAAVVDL
QQKLNIQFLGQLDRATFDQNAALIADETVRRRARHAVYENERTQEAVKALQANDLVGFGQ
LMNASHQSLKADYEVTGLELDTLAETAQQVPGVLGARMTGAGFGGCAIALVHRDAVATLE
KTVGERYEAVVGYAPSFYAANIGTGAHWVGEI
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgacaacaatttatgatgaactcgcaaatgtctatcacacccagtttcaaacacaacca
accgacaaattcttctcaccaggtcggattaatttgattggggaacatacggattataat
gggggccatgttttcccagcagcgattaccttgggcacttatggggtcgccggtaagcgt
accgataaactggtcaagttgtattcgaccaatatgcctgaggctggggtgattacattt
gagattgatgatgaaagtaagctgccacatgggtcatgggggaacttcgttaaaggtgtg
ttgcaagccttacgtgggtacggcaaccagtttgagacgggatttgaattggtcatttct
ggcaatattcccaatgggtcaggtctctcatcgtcatcatcattagaattattgattggg
gtggtcgccaaaaaattgtatgacttaaaggttccccgattacaattagtggcgagtggg
caacgggctgaaaatgactttgtcggcgttaatactgggattatggatcagtttgcgatt
ggttttggtgaggaggatcacgccatttacttggatacgaacacgatgatttatgagatg
atcccgacgcacttaggggatcatgtgattgtcatcatgaataccaataaacggcgtgaa
ttagccgattcaaaatacaatgagcgtgtgcgtgaaacgcaagcggcggtcgttgactta
caacaaaaactcaacattcaattccttgggcaattggatcgtgcgacgtttgatcaaaat
gcggcgttgattgcggatgagacggtgcgccgccgtgcgcgtcatgcggtctatgaaaat
gaacggacgcaagaggcagtgaaagccctccaggccaatgatttggttggatttgggcaa
ttgatgaatgcctcacaccaatcgctaaaagcagattacgaagtcacaggacttgaactt
gataccttggctgaaacggcacaacaggtgcctggtgtcttaggcgcacgaatgactggg
gctggttttggtggctgtgcaattgccttagtgcatcgcgatgcagtcgcaacactagaa
aaaacagttggcgagcgctatgaagcggtggtgggttatgcgccatcattttatgcggct
aacattggcacaggtgcacattgggttggcgaaatttga

DBGET integrated database retrieval system