KEGG   Leuconostoc garlicum: A9176_00870
Entry
A9176_00870       CDS       T04802                                 

Definition
(GenBank) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_00870
   00500 Starch and sucrose metabolism
    A9176_00870
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_00870
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     A9176_00870
SSDB
Motif
Pfam: ROK
Other DBs
NCBI-ProteinID: AQN79040
LinkDB
Position
complement(187514..188380)
AA seq 288 aa
MGLLGAIEAGGTKFVVAVADEDFNIIDRTAFPTLDGEKTLDQVIAFFDQYDNIDAIGIAA
FGPIDIVPESKTYGYVLDTPKHGWSGYDFLGRMKAWRDIPYYWTTDVNGAGWAEFTTGAA
KDVDNMVYLTVGTGVGAGIVSGGHLVSGYGHPEAGHIFLQKHPEDTYAGHCPFHGANCLE
GLAVGPAIEERWGMSAKEIPDDHLAWRMEAFYLAQAILDYTMILRPEKVVLGGGVPHREI
LFPLIRESFAEQMHDYLAVPPLDDYIVPVANGDNAGILGCFYLAKTLR
NT seq 867 nt   +upstreamnt  +downstreamnt
atgggactattaggtgcaattgaagcaggtggtacaaagtttgtggtggctgttgccgat
gaagactttaacattatcgatcggacagcctttccaacattggatggtgaaaagacgtta
gatcaggtcattgcgttctttgaccaatatgataacatcgacgccattgggattgccgcc
tttgggccaattgatattgtgcctgaatcaaagacttacggttatgtcctcgacacgcca
aaacacggctggtcagggtatgatttcttagggcggatgaaggcttggcgtgatatccct
tactactggacaacggatgtcaatggtgctggttgggctgagtttactacaggcgctgcc
aaagacgttgacaatatggtgtatttgacagtcggcacgggtgttggggccggtattgtc
tctggtggacaccttgtcagtggttatggtcacccagaagccggtcacattttcttgcaa
aagcatccagaagacacgtatgctgggcactgcccattccacggtgcgaactgtttggaa
ggtttggcagttggaccagccatcgaagaacgctggggcatgagtgctaaggaaatccct
gatgatcatttggcatggcggatggaagccttctacttggcacaagcgattttggattat
acgatgatcttgcgtccagaaaaggtggtacttggtggcggcgtgccacaccgtgagatt
cttttccccttaattcgggaaagctttgcggaacaaatgcatgattatttggcagtgcca
ccattggatgactatatcgtgccagtggctaatggcgataatgctggcatcctcggttgc
ttctatttggcgaaaacattgcgataa

KEGG   Leuconostoc garlicum: A9176_07975
Entry
A9176_07975       CDS       T04802                                 

Definition
(GenBank) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_07975
   00500 Starch and sucrose metabolism
    A9176_07975
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_07975
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     A9176_07975
SSDB
Motif
Pfam: ROK
Other DBs
NCBI-ProteinID: AQN80286
LinkDB
Position
complement(1581982..1582848)
AA seq 288 aa
MGLLGAIEAGGTKFVVAVADEDFNIIDRTAFPTLDGEKTLDQVIAFFDQYDNIDAIGIAA
FGPIDIVPESKTYGYVLDTPKHGWSGYNFLGRMKAWRDIPYYWTTDVNGAGWAEFTTGAA
KDVDNMVYLTVGTGVGAGIVSGGQLVSGYGHPEAGHIFLQKHPEDTYAGHCPFHGANCLE
GLAAGPAIEERWGMSAKEIPDDHLAWRMEAFYLAQAILDYTMILRPEKVVLGGGVPHREI
LFPLIRESFAEQMSDYLAVPPLDDYIVPVANGDNAGILGCFYLAKTLL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgggactattaggtgcaattgaagcaggtggtacaaagtttgtggtggctgttgccgat
gaagactttaacattatcgatcgaacagccttcccaacattggatggcgaaaagacgtta
gatcaggtgattgcgttctttgaccaatatgataacatcgacgccattgggattgccgcc
tttgggccaattgatattgtgcctgaatcaaagacttacggctatgtgctggacacgcca
aaacacggctggtcagggtataattttttaggccggatgaaggcttggcgtgatattcct
tattactggaccacggatgtcaatggggctggttgggcggagtttacgacaggcgctgcc
aaagacgttgacaatatggtgtatttgacagtcggcacgggtgttggggccggtattgtc
tctggtggacagcttgttagtggttatggtcacccagaagccggtcatatcttcttgcaa
aagcatccagaagacacgtatgcgggtcattgcccattccacggtgcgaactgtttggaa
ggtttggcagctggaccagccatcgaagaacgctggggcatgagtgctaaggaaatccct
gatgatcatttggcatggcgcatggaagccttctacttggcacaagcgattttggactat
acgatgatcttgcgtccagaaaaggtggtacttggtggcggcgtgccacatcgtgagatt
cttttccccttaattcgggaaagctttgcggaacaaatgagcgattatttggcagtgcca
ccattggatgactatatcgtgccagtggctaatggcgataatgccggcatcctcggttgc
ttctatttggcgaaaacattactataa

DBGET integrated database retrieval system