KEGG   Leuconostoc garlicum: A9176_00875
Entry
A9176_00875       CDS       T04802                                 

Definition
(GenBank) glyoxalase
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00280  Valine, leucine and isoleucine degradation
lgc00630  Glyoxylate and dicarboxylate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9176_00875
   00640 Propanoate metabolism
    A9176_00875
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9176_00875
Enzymes [BR:lgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     A9176_00875
SSDB
Motif
Pfam: Glyoxalase_4 Glyoxalase Glyoxalase_3 Frankia_peptide
Other DBs
NCBI-ProteinID: AQN79041
LinkDB
Position
complement(188836..189219)
AA seq 127 aa
MAFSDYYSGLQHIGIPTHDLAAAEAFWTKLGFTKIGDFPVGQVIFMQRDNLVIETWYQEA
VANQPGAINHISLDTTDAEAAFAAAKAEGFDLIDSEVQQLAFWDKGIKFFNIQGPDAVIV
EFCEIVK
NT seq 384 nt   +upstreamnt  +downstreamnt
atggcattttcagattattattcaggtttacaacacatcggtataccaacacatgatttg
gcggctgcagaagctttttggacaaaattagggtttacgaaaattggtgattttccagtt
ggacaagtcatttttatgcaacgtgacaatcttgtgattgaaacatggtaccaagaagcg
gttgccaatcaaccaggtgcaattaaccatatctcattggacacgacagatgctgaagca
gcttttgcggctgcaaaggctgaaggttttgatctgattgattcagaagtacaacaatta
gcattttgggacaaagggattaagttctttaatatccaaggcccagatgccgtaattgta
gaattctgtgaaattgtaaaatag

DBGET integrated database retrieval system