KEGG   Leuconostoc garlicum: A9176_01075
Entry
A9176_01075       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_01075
   00640 Propanoate metabolism
    A9176_01075
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_01075
Enzymes [BR:lgc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     A9176_01075
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A9176_01075
SSDB
Motif
Pfam: ACCA Carboxyl_trans MdcE ECH_1
Other DBs
NCBI-ProteinID: AQN79077
LinkDB
Position
complement(223612..224412)
AA seq 266 aa
MAVNIGLKLFKHELTPAEVVKKSREDRFLAREIIDGIFTDFVELHGDRLSGDDMSVIGGI
AALNGKPVTVIAIDKGVDIQDKLSKRNGSPEPWGYRKAQRLMQQANKFHRPIVTFINTPG
AFPGKTAEAQGQGEAIAKSILESMKLTVPMIAIIYGEGGSGGALALATSDQVWMFQNATY
SILSPEGFASILWKDSKRADEAAAVMGITAKDLLEKGVIEYIIPESRNHPRVFNLIRQRL
DDEFARLNALTPEELLKQRRARFRAF
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcagtcaatattggattaaaattatttaagcatgaattaacgccagctgaagtggtg
aaaaagtcacgtgaagaccgctttttggcgcgtgaaattattgatggtatttttacggac
tttgttgaattgcatggcgatcgtttgagtggggatgacatgtcggtgattggtggcatt
gccgctttaaatggcaagccagtgactgtcattgccattgataagggtgttgatattcaa
gataagctgagcaaacgcaatgggtcgcctgaaccttggggttatcgcaaagcacaacgc
ttgatgcaacaagccaacaaatttcatcgcccaattgtgacgtttattaacacgccaggg
gcatttccaggtaaaacggcggaagcgcaaggccaaggcgaagcgattgccaagtctatt
ttagaatctatgaaattgacggtgccaatgattgccattatttatggagaaggtggttct
ggtggcgctttggcgttggccacgagtgatcaagtctggatgttccaaaatgcgacttat
tccattttgtcaccggaaggttttgcatctattttatggaaagatagtaagcgtgctgat
gaggccgccgctgtcatgggtatcacggctaaggatcttttggaaaagggtgtgattgaa
tatattattcccgaatcacggaatcatccgcgtgtctttaatttgattcgccagcgatta
gacgatgaatttgcgcgactaaatgcgttaacgccagaagaattacttaagcaacgacgt
gcacggtttagagcgttttaa

KEGG   Leuconostoc garlicum: A9176_01080
Entry
A9176_01080       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_01080
   00640 Propanoate metabolism
    A9176_01080
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_01080
Enzymes [BR:lgc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     A9176_01080
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A9176_01080
SSDB
Motif
Pfam: Carboxyl_trans Ribosomal_L37e zf-ACC TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: AQN79078
LinkDB
Position
complement(224414..225253)
AA seq 279 aa
MDLYDNQKSTAKIKRDASVNERIPDGLFLACPYCGVQMYNKQLGPFRVCAHCGYGFRLQA
QERVDLLTQSFEEMDADIEMTTPEFPGYADKLARAKSQTGLGESVLTGVATIENEKVALG
VMDSYFMMGSLGSMTGEKITRLFEYATDKKLPVVLFTASGGARMQEGINSLMQMAKVSAA
VAAHQEAGLLYLVVLTDPTTGGVTASFAMQGDITLAEPHALVGFAGARVIESTIHEKLPK
DFQRVETLLENGFVDQIVPRPELSAIIAKLVRLHRVSEV
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatttatacgataatcaaaaatcaaccgctaaaattaagcgggatgcatcggtcaat
gaacgcatcccagacgggcttttcttagcttgtccttattgcggtgttcaaatgtacaat
aagcaattgggaccgtttcgtgtatgcgcgcactgtggttatggcttccgtttgcaagcg
caagaacgtgtcgatttgctcacgcaatcatttgaagaaatggatgctgacattgaaatg
acaacaccagaatttcctggctatgcggataagctcgcgcgggcgaaatcacaaacaggt
ttaggcgaatccgtattgaccggtgtggccacaattgaaaatgaaaaagtggcgctaggc
gtcatggattcttatttcatgatggggtcattgggatcaatgactggtgaaaaaatcacc
cgcttgtttgaatatgcgacggataaaaaattaccggtagtattgttcacggcttctggt
ggggcacggatgcaagaaggtattaattccttgatgcaaatggccaaagtgtcagcggca
gtggcggcgcatcaagaagctggcctcctttatttggtcgtactgacagatccaacaact
ggtggggtgacggccagtttcgccatgcaaggcgatattacgttagctgaaccgcatgct
ttggttggctttgctggtgcacgtgtgattgaatcaacgattcatgagaagctaccaaag
gactttcagcgtgtcgaaacgttactagaaaatggctttgttgatcaaattgtgccccgt
cctgaactgagcgccattattgctaaactggtgaggttgcatcgggtgtcggaggtataa

KEGG   Leuconostoc garlicum: A9176_01085
Entry
A9176_01085       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_01085
   00640 Propanoate metabolism
    A9176_01085
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_01085
Enzymes [BR:lgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     A9176_01085
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A9176_01085
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATPgrasp_Ter
Other DBs
NCBI-ProteinID: AQN79079
LinkDB
Position
complement(225390..226766)
AA seq 458 aa
MFKKVLVANRGEIAVRIIRTLKEMGIGSVAIYSTADKDSLHVQIADEAIAVGGPKPKDSY
LNMKNILSAALLSGAEAIHPGYGFLAENALFAEMVGEVGIQWIGPRPETIELMGNKANAR
EEMRRAGVPVIPGSEGFIRDFDEAKAVADRIGYPLLLKAAAGGGGKGMRFVYGEDELSDK
FDDAQNEARAAFGDDHMYIEKVMERVRHIEMQLLRDENGHVIYLPERNCSLQRNNQKVLE
ESPATGVTPAMRAELGEIVTRAAQALGYVNTGTIEFLQDHEGAFYFMEMNTRIQVEHPVS
EMVTGLDLIRLQIAVAAGEDLPVTQADVQVQGHAIEVRLTAEQPEKHFAPSAGTVDFVFL
PTGGPGIRIDSALFNGDKIQPFYDSMIGKLIVHGADRAQAMAKMRRIVDETVVRGVATSR
AFQQALLADPQVQRGEFDTRYLESDFLPRWLDSLPATE
NT seq 1377 nt   +upstreamnt  +downstreamnt
gtgtttaaaaaagtattggttgccaaccgtggtgaaattgcggttcgtattatccgaacg
ttaaaagaaatgggcattgggtcagtggcgatttattcgaccgctgataaggatagcctg
catgttcaaatcgctgatgaagccatcgctgtcggtgggccaaagccaaaagactcttat
ttgaacatgaaaaacattttgagcgccgccttgctatctggggcagaagccattcaccca
ggttacggtttcttagctgaaaatgcgttgtttgctgaaatggtcggtgaggtcggaatt
caatggatcgggccacggccagagaccatcgaattaatgggtaataaagcgaacgcccgt
gaagaaatgcgccgcgctggtgtgcctgtcattccaggatctgaagggtttattcgagat
tttgacgaagccaaggctgtggccgatcgcattggttatcctttgttgctcaaggctgct
gctggtggtggtggtaaagggatgcgctttgtatacggcgaagatgagctctcagataaa
tttgatgatgcgcaaaacgaagcccgtgctgcttttggcgatgaccatatgtatatcgaa
aaggttatggaacgcgtgcggcatattgaaatgcaattgttgcgtgatgaaaatggccat
gtgatttatttgcctgaacgtaattgttctttgcaacgtaataaccaaaaagtgttagaa
gaatcgccagcaactggtgtgacgccagcaatgcgtgctgaattgggtgaaattgtgacc
cgcgcagctcaagctttgggctatgtgaatacagggacgattgaatttttgcaagatcat
gaaggcgccttttatttcatggaaatgaacacgcgaattcaagtggaacatcccgtttca
gaaatggtcaccggtttagatttgattcgattgcagattgccgtggccgctggcgaagat
ttgccagtgacgcaagctgatgtgcaagtgcaaggtcatgcaattgaagtgcgtttgacg
gctgaacagccagaaaagcattttgcccctagtgccgggacagttgatttcgtctttctc
ccaactggtgggcctggtattcgtattgattcggcattatttaatggtgataaaatccaa
ccattctatgattcaatgattggtaagctcattgtgcatggtgctgatcgtgcgcaagcg
atggctaagatgcgtcggattgtggatgaaacggtggtccgtggcgtcgccacgagccgc
gccttccaacaggcattgttagctgatccccaagtacaacgtggagaatttgatacacgt
tacctagaaagtgactttttaccacgctggcttgatagtttgccagcgactgaataa

KEGG   Leuconostoc garlicum: A9176_01095
Entry
A9176_01095       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_01095
   00640 Propanoate metabolism
    A9176_01095
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_01095
SSDB
Motif
Pfam: Biotin_lipoyl GCV_H RnfC_N UPF0231
Other DBs
NCBI-ProteinID: AQN79080
LinkDB
Position
complement(227280..227732)
AA seq 150 aa
MSLNIDEIRSLMADLENSSLREFQITDGDFSLHLSKNDNAAIVAPALTAAAEPVVANDAP
NEHPLAKPVTAGVEIVAPMVGTVYLQPKPEAPMFKQVGDKVAVGETVAVIEAMKLMTEIH
SEVAGTIAEVLVENEEVVDYNKPLYIVTPA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgagtttaaatatcgatgaaatccgcagcttgatggcggatctagaaaatagttcatta
cgcgaatttcaaattaccgacggtgattttagtttgcatttgtcaaaaaatgacaacgcg
gcgattgtcgcaccagcactcactgccgccgctgaaccagtagtggctaacgatgcacct
aacgaacatccattggcaaaaccagtgacagcgggtgtcgaaatcgttgcgccaatggtt
ggcacagtgtatttgcaaccaaaaccagaagcgccaatgtttaaacaagttggtgacaag
gtagcggttggtgaaacagtagctgtgattgaagcgatgaaactgatgaccgaaattcac
agtgaagttgctggcacaattgccgaagttttggttgaaaacgaagaagtggtggactat
aacaagccactttatatcgtgacaccagcataa

KEGG   Leuconostoc garlicum: A9176_06715
Entry
A9176_06715       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_06715
   00640 Propanoate metabolism
    A9176_06715
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_06715
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N IFT81_CH YqfD QRPTase_N
Other DBs
NCBI-ProteinID: AQN80056
LinkDB
Position
1328727..1329128
AA seq 133 aa
MEIDDIAAIVKILNDNNLSHISFKKGDSKISVSKNINREIQIADSIDIAKEQPQQEMRYI
VSPTIGTFYAASDPESSPFVTVGQTVTQSTVVGVAEAMKMMTNILADNEGVIAEVLVQDG
DAIEYGQKLFRLS
NT seq 402 nt   +upstreamnt  +downstreamnt
atggaaattgatgacattgctgctatcgtaaagatattaaacgacaataaccttagtcat
atctcatttaaaaaaggtgattcgaaaattagtgtctcaaaaaacattaatcgtgagatt
caaatagctgacagcatagatattgcaaaagaacaaccacagcaagagatgcgttacatc
gtatcaccaacaattggcacgttttatgccgcgtctgatcctgaatcgtcaccctttgtt
acagtgggacagacagtaacccaatcgactgtagttggtgttgcagaagccatgaaaatg
atgaccaacatcttagcagataatgagggcgtgattgctgaggttttagttcaagatggt
gatgcaattgaatatggacaaaaattgtttaggttgtcgtga

KEGG   Leuconostoc garlicum: A9176_06720
Entry
A9176_06720       CDS       T04802                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00061  Fatty acid biosynthesis
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01212  Fatty acid metabolism
Module
lgc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_06720
   00640 Propanoate metabolism
    A9176_06720
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9176_06720
Enzymes [BR:lgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     A9176_06720
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A9176_06720
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp_3
Other DBs
NCBI-ProteinID: AQN80057
LinkDB
Position
1329128..1330468
AA seq 446 aa
MHSTVEHNFKILIANRGEIAVRIIRAAKTLGFTTVAVYSSADKASLHVAMADEAVQIGPA
NAIDSYLNQHAILAAAEITHADAIHPGYGFLSENADFASNVESMGLTFIGPTSDTISQMG
DKASARQFMSETGVPIVSGSDVFFDNVHAGLTQANQIGYPVMLKSVAGGGGKGMRLIPSQ
DSFQSLFELAQNEIKASVGDGRMYLEKFIDQPRHIEVQVLGDGLGNALVLGERDCTIQSH
HQKVIEEAPSQYLDAATRSEMLEVALKATKKMAYRSAGTFEFLYQGPGRYYFMEMNTRIQ
VEHAISEEISGIDIVGAQLQLAYGQKLADIPVDTKKKFAVEARVSAQSSGTISGLHLPAG
LGVRVETAIYQGYTVPPFYDAMIVKIIASGRDRQEALTRLKIAIEETVILGVKTNLDLLL
RILTHPDFTSEESRTDIDWLDHQLEE
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgcacagtacagtagaacacaactttaaaattttaattgctaaccgtggtgaaattgcg
gtcagaattattcgagcggcaaaaacattggggttcacaacagtagcggtttattcgtcc
gccgacaaagcatcgctacatgtcgcaatggcagacgaggccgtccaaataggtcctgca
aatgcgattgatagctatttgaaccaacatgcaattttagcggcagcagagattacacat
gcggatgccattcatcctggttatggctttttgtctgaaaacgcggattttgccagtaac
gtcgaatcaatgggtcttacatttattggcccaacaagtgataccatttctcaaatggga
gataaggctagtgcacgtcaattcatgtcagaaaccggcgtaccgattgtgtctggaagt
gatgttttttttgataatgtacatgctggtttgacacaggctaatcaaattggttatcca
gtgatgcttaagtctgttgctggtggtggcggaaaaggcatgcgactgattccaagccaa
gatagttttcaatcattattcgagcttgcccagaatgaaattaaagcgtcagttggtgat
ggccgaatgtatcttgagaaatttattgatcagccacgacatatcgaagttcaggtatta
ggtgatgggttaggaaatgcccttgtcttgggtgaacgtgactgcaccattcagagtcat
catcaaaaagtcattgaagaagcccccagtcaatacctagatgcagccacacgctctgag
atgttagaagttgcgttaaaagcaacaaaaaagatggcctatcgtagtgcgggtactttt
gaatttttgtatcaaggccctggtcgttattactttatggagatgaatacacgaattcaa
gtggaacatgcgatttctgaggagatttcaggtattgatattgtaggtgcacaattacaa
ttagcctacggtcaaaagctagctgatatacctgtagatactaaaaaaaagtttgctgtt
gaggcaagagtttccgcgcaatcatccggtacaattagcggtctccatttacctgccggt
ttaggcgtacgcgttgaaactgctatatatcaaggttacacagtaccaccattttatgat
gcaatgattgtcaaaatcattgcatcaggccgtgatcgtcaagaagccttaacacgttta
aaaatcgctattgaagaaacagtgatattaggcgttaaaacgaatttggatttattacta
cgtatcttgacacaccctgacttcacttcagaggaaagtagaacagatattgactggctc
gaccatcaacttgaggaatag

DBGET integrated database retrieval system