KEGG   Leuconostoc garlicum: A9176_01310
Entry
A9176_01310       CDS       T04802                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00030  Pentose phosphate pathway
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_01310 (pgi)
   00030 Pentose phosphate pathway
    A9176_01310 (pgi)
   00500 Starch and sucrose metabolism
    A9176_01310 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_01310 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgc04147]
    A9176_01310 (pgi)
Enzymes [BR:lgc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     A9176_01310 (pgi)
Exosome [BR:lgc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A9176_01310 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   A9176_01310 (pgi)
  Exosomal proteins of colorectal cancer cells
   A9176_01310 (pgi)
SSDB
Motif
Pfam: PGI Ku_N
Other DBs
NCBI-ProteinID: AQN80366
LinkDB
Position
complement(268665..270017)
AA seq 450 aa
MAHITLDTKNIENFVGEHEFSEMQPLITMADQQLRNRTGAGAEYSDWLTLPTDYDKAEFV
RIKAAAKRIQSESKILVVIGIGGSYLGAKMAVDFLNPMFNNELPDDQRQGVKIYFAGNST
SAAYLNDLVRVIGDQDFSVNVISKSGTTTEPSIAFRVFKQLLEKKYGAEAAKQRIYATTD
ANRGALHDEAVAAGYETFTIPDGVGGRFSVLTAVGLLPIAASGADIDALMAGAKDAQEAY
SDADLNKNAAYKYAAARRILYDKGYTTELLINWEPSMQYLSEWWKQLMGESEGKNQKGIY
PSSANYSTDLHSLGQYIQEGRRDLFETVVKLDNPVSNLDLPREADNNDGLQYLEGITIDE
VNTKASQGVILAHVDGGVPNLAVHLPAQDAYTLGYMIYFFELAVGASGYLFGINPFNQPG
VEAYKTAMFALLGKPGYEAETQAFRARLGE
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggcacacatcacacttgatacaaaaaacatcgaaaatttcgtcggcgaacacgaattt
tctgaaatgcaaccattaattacgatggcggatcaacaactacgcaatcggacgggtgca
ggcgctgaatattcggattggctcacattgccaacggattatgacaaggcagaatttgtg
cggattaaagcagccgcaaaacgcattcaaagcgagtcaaagattcttgttgtcattggt
attggtggctcatatcttggggctaagatggcagtggatttcttgaatccaatgtttaac
aatgaattaccagatgaccaacgtcaaggtgtcaagatttactttgccggtaactcaacg
tcagccgcataccttaacgatttggtacgtgttattggggaccaagacttctcagtgaat
gtgatttcaaagtctggaacaacaacagaaccttcaattgccttccgtgtgttcaagcaa
ttacttgaaaagaagtatggtgctgaggctgctaagcaacgtatttatgccacgactgat
gctaatcgtggggcactacatgacgaagctgtggcagctgggtatgaaactttcacgatc
ccagatggtgtcggtgggcgtttctcagtcttgacggctgtcgggctattgccaattgct
gctagcggtgctgacattgatgcattgatggcgggggccaaggatgcgcaagaggcttac
tcagatgctgatttgaataaaaacgcggcttataaatatgccgctgcccgtcgtattttg
tacgataagggttatacaacagaacttttaattaactgggaaccttcaatgcaatatcta
tctgaatggtggaagcaattgatgggtgaatcagaaggtaagaaccaaaagggtatttat
ccctcatcagccaattattcaactgacttacattcacttggtcaatatattcaagaaggt
cgtcgtgacttgtttgaaacagttgttaagcttgataatcctgtttcaaatttggatttg
ccacgcgaagcagataacaatgatggcttgcaatatcttgaaggcattaccattgatgaa
gttaacacaaaggcgtcacaaggcgttatcttagcgcatgtcgatggtggtgtgcctaac
ttggctgtgcacttacctgcacaagacgcctacacgttgggttacatgatttacttcttt
gaactagcagtgggcgcatcaggttatctatttggcattaatccatttaaccaacctggc
gttgaagcctataagacagccatgtttgccttactgggtaagccaggctatgaagcagaa
acgcaagcattccgtgcgcgtttaggtgaataa

DBGET integrated database retrieval system