KEGG   Leuconostoc garlicum: A9176_01605Help
Entry
A9176_01605       CDS       T04802                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00473  D-Alanine metabolism
lgc00550  Peptidoglycan biosynthesis
lgc01100  Metabolic pathways
lgc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9176_01605
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9176_01605
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A9176_01605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lgc01011]
    A9176_01605
Enzymes [BR:lgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A9176_01605
Peptidoglycan biosynthesis and degradation proteins [BR:lgc01011]
 Precursor biosynthesis
  Amino acid ligase
   A9176_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp SusD-like_2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AQN79165
LinkDB All DBs
Position
complement(324632..325765)
Genome map
AA seq 377 aa AA seqDB search
MTKKHVALLFGGNSSEHDVSKRSAQNYYQAIEASGKYDITVFAIAQNGYFLDPESSKRVL
ALEDEQPIVDAFMAKVDTKDPLARISALREAGDFDIFFPVVHGNLGEDGTLQGLFRLLNK
PFVGAPLRGHAVSFDKAMTKELLTVNNIRNTNYVVLDEKTAQDWTWDKVVATFGDVVFVK
AANQGSSVGISRATTAEEFAAALADSFQYDYKVLVEQAVKGPRELEVGVIGNDEPLVSEI
GAHAVPNQGDGDGWYDYNNKFVDNSAVEFEIPAKLPEAVTQEVKDMALKAYKVLNLRGEA
RMDFLLDENDVPYLGEPNTLPGFTNMSLFKRLWDYSDIDNVALVEKMIAYGFEEFEKNAK
LSYQFVTLGEEKIGKFN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaacacgttgccctattatttggtggaaactcttctgaacatgatgtgtca
aagcgttccgcccaaaactactatcaagcgattgaagcgagtggcaagtacgatattacc
gtatttgccattgcgcaaaatggctatttcctagatcctgaaagctcaaaacgcgtgttg
gccttagaagatgaacagccaattgttgatgctttcatggctaaagttgatacgaaggat
ccgttggcgcgcattagtgctttgcgtgaagcaggagattttgatattttcttcccagtc
gtgcatggtaatcttggcgaagatggcacactacaaggcctctttcgacttttgaataag
ccatttgttggtgcgccactgcgtggtcatgcggtcagctttgataaggctatgacgaaa
gaattgctaacggttaacaatatccgcaataccaattacgtcgttttggatgaaaaaaca
gcgcaagattggacttgggataaagttgtcgcaacatttggtgatgttgtgttcgtgaag
gcggcaaaccaagggtcatcagtcggcatttcccgtgccacaacagctgaagaatttgcg
gctgcgttggctgattctttccaatatgactacaaagtcttggtggaacaagcagtcaag
ggcccacgcgaacttgaagttggtgtgatcggtaatgatgaaccattggtctcagaaatt
ggcgcccatgccgtaccaaatcagggtgatggcgatggttggtatgattacaacaacaag
tttgtggataactctgccgttgaatttgaaatcccagcaaaattgccagaagccgtcaca
caagaagtaaaagacatggctttgaaagcttataaggttttgaacttacgtggtgaagca
cggatggactttttgctagatgaaaatgatgtcccttatttgggcgaacctaacacgttg
ccaggctttacaaacatgtcattgtttaagcgcttgtgggattactcagatattgacaat
gtggcacttgttgaaaagatgattgcctatggttttgaagaattcgagaagaatgccaag
ttaagttatcaatttgtcacattaggtgaagaaaaaatagggaagtttaattaa

DBGET integrated database retrieval system