KEGG   Leuconostoc garlicum: A9176_02080
Entry
A9176_02080       CDS       T04802                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_02080
   00500 Starch and sucrose metabolism
    A9176_02080
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A9176_02080
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Other DBs
NCBI-ProteinID: AQN79250
LinkDB
Position
complement(423205..424686)
AA seq 493 aa
MPKKGLQLPEDFLWGGAIAAHQAEGYWDADGKGVSIADVLTAGSHEQPRGITDGVIPGKN
YPNHHGIYFYKTYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDAEPNEAGLAFYDDLFDT
MHALGIEPVITLQHFEMPYHLVTAYGGWENRQVIDYFEKYVRVVFERYKDKVTYWITHNE
ISNQANQAEKSSLSEFLVWTNSGLKFTPEMTVDERQAAMYQAAHNELVASARAVRIGHDI
NPNFKIGAMLNVGTLYSASTKPADQLAVQKARQQRDWFSDVHIRGAYPHELEQLFARTGW
RADVTAQDFEDLAAGTVDYLSISYYASSVIRAKSDTDAELDAATQWETVPNTEIKASDWG
WAIDPQGLRYALNEINDLYPGLPIMIVENGFGAYDQLDTTTDEPTVHDDYRIAYLGAHIA
EVEKAVVNDGIPVIGYLSWGPIDIVSAGTGEMKKRYGYIYVDLDDFGEGSAKRYKKDSFH
WYQQVIASRGENL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgccaaaaaaaggattacaattaccagaagattttctatggggcggcgcgattgctgcg
catcaagccgaaggatactgggacgcagatggtaaaggtgtttcgattgccgatgtttta
acagctgggtcgcatgaacaaccccgtggaatcaccgacggtgtcataccagggaagaac
tatcccaaccatcacgggatttatttctataaaacgtataaggaagacttagctttgatg
gccgaaatgggctttaaagcctttcgaacatcgattgcctggacacgcatttttccaaat
ggcgacgatgctgaaccaaatgaagcagggttagccttttatgatgacttgtttgacaca
atgcatgcacttggtattgagccagttattacgttacaacactttgagatgccttatcat
ctggtgacggcctatggtggttgggaaaatcggcaagtgattgattactttgaaaaatat
gtgcgggtcgtgtttgagcgttacaaagacaaggtgacttattggattacgcataacgaa
atttccaatcaggccaatcaagcggaaaagagtagtctgtcagaatttctcgtgtggacg
aattctggtttgaaattcacgccagagatgacggttgacgaacggcaagccgcgatgtat
caagcggcccataacgaattggttgcaagtgctcgtgctgtgcgcattgggcatgacatc
aatccaaactttaaaattggtgcaatgttaaatgttgggacgctttattctgcatcgaca
aaaccagctgatcaattggcagtgcaaaaagccagacagcaacgtgactggtttagcgat
gtgcatattcgtggcgcttacccacatgaattggaacaattatttgcccgtacaggctgg
cgtgctgatgtgactgcgcaagattttgaagatttagctgctggtacggtggattatttg
agcatttcttactatgcgtcatcggtcattcgggcaaagtcggatacggatgcggaatta
gacgcggccacgcaatgggaaacggtccccaacactgaaatcaaagccagtgattggggc
tgggcaattgatccacaaggcttacgctatgcgttgaatgaaattaacgacctttatcca
gggttgccaattatgattgttgaaaatgggtttggggcgtatgaccaacttgacacgact
actgatgagccgactgtgcatgatgattaccgaatagcttatttaggggcgcacattgct
gaagttgaaaaagcagtggttaatgatgggattcccgttatcggttacttgtcttgggga
ccgattgatattgtgtcggccggtacaggcgaaatgaagaagcgttatggttatatttat
gttgatttagatgattttggcgaaggcagtgccaagcgctataagaaggatagttttcac
tggtatcaacaagtgattgctagtcgcggtgaaaatttataa

KEGG   Leuconostoc garlicum: A9176_02105
Entry
A9176_02105       CDS       T04802                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_02105
   00500 Starch and sucrose metabolism
    A9176_02105
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A9176_02105
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AQN79255
LinkDB
Position
complement(428968..430434)
AA seq 488 aa
MQAKQFPTDFLWGGATAANQFEGGWQDGGRGPATSDTAVAIDPKDRKTALDFTAPMSKEK
VLAALNDAEGRYPKRWGSDFYHRYKEDIALYAEMGLKTFRLSIAWSRIFPNGDDAAPNEA
GLQFYDAVFDELRKYNIEPLVTLSHYETPIGIALNYGGWQNRAVIDLFVKYAKTVITRYQ
DKVKYWLTFNEINVIGVSGYVGGALLSDDDAYTLQDRFQAAHHQFVASSLVTQFAHELNP
DLKIGMMLARMQAYPATPNPLDVLQALKLDHENLFYSDVQVRGKYPAYAKRFFAENGINL
QMAPSDEAILAANPVDFMSFSYYMSTVARPEPGANIEKTSGNFVNGEANPYLESSDWGWQ
IDSVGLRITLNYLYDRYQVPLFVVENGLGALDTVTADGQIHDEYRIDYVKQHIQQMYEAI
QDGVELLGYTTWGITDLVSAGTSEFSKRYGFVYVDMDDQGQGTFDRRRKDSFYWYQHVIA
TRGAAAFD
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgcaagcgaaacaatttccgacagactttctctggggtggcgccaccgcggccaatcaa
tttgaaggcggctggcaagatggtgggcgtgggccggccacgtcggatacggcggtagcc
attgatcccaaggatcgtaagaccgcactcgattttacagcaccaatgagcaaagaaaag
gtcttggcagctttaaatgatgcagagggacgctatcccaagcgttggggttcagacttc
tatcatcgctacaaagaagatattgcgttatatgcagaaatgggactcaagacgtttcga
ctgtcgattgcttggtcacgtatctttcctaatggggatgatgcggcacccaatgaagct
ggcttacaattctatgatgcagtgtttgatgaattacgcaaatataatattgaaccgttg
gtcacgctatcgcactatgaaacgccgattgggattgcgttaaattatggtggttggcag
aatcgcgcggtaattgatttatttgtcaagtatgccaaaacggtaatcacgcgctatcaa
gacaaagtgaagtactggttaacttttaatgaaatcaatgttatcggggtgtctggttac
gtgggcggtgctttactgtcagatgatgacgcgtataccctacaagatcggttccaagca
gcgcaccatcagtttgtcgcttctagtttagtgacacaatttgcgcatgagctgaaccct
gatttgaaaattgggatgatgctggcgcgaatgcaagcttatccggcaacacctaatcca
ctagatgtcttgcaagccttaaagttggatcacgaaaatctattttattcagatgttcag
gtacgtggtaagtatcctgcctatgctaagcgtttctttgctgaaaatggcatcaatttg
cagatggcaccttcagatgaggcaatattggcggctaatccagttgactttatgtcattt
tcatactatatgagcacggtggcgcgtcctgagccaggcgcaaatattgaaaaaacatcg
ggtaattttgttaacggtgaggccaatccgtatttagagagttcagattggggctggcag
attgattcggttggcttgcgcatcacgttaaattatttgtatgatcgttatcaagtaccg
ctgtttgttgtcgaaaatggtttaggagcgcttgatacggtgacagctgatggtcagatt
catgatgagtatcgcattgattatgtgaagcaacatattcaacaaatgtatgaagccatt
caagatggcgttgaacttttgggttacacgacttgggggattactgatttggtgtcagca
gggacatcggagttttctaaacgctatggttttgtttatgttgacatggatgaccaaggt
caggggacatttgaccggcgacgcaaagacagtttttattggtatcaacacgtgattgcg
acgcgtggtgcggccgcatttgattaa

KEGG   Leuconostoc garlicum: A9176_06570
Entry
A9176_06570       CDS       T04802                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_06570
   00500 Starch and sucrose metabolism
    A9176_06570
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A9176_06570
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AQN80029
LinkDB
Position
1301435..1302907
AA seq 490 aa
MSKETYQLNQDFLWGGAIAAHQAEGAWQAGGKGVSIADVLTAGAHNLPRQITDGVVEGLN
YPNHHGIEFYDTYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDAEPNEAGLAFYDDLFDE
MHKHGIEPVITLQHFEMPYHLVEAYGGWSNRQVIDLFVRYAEVVFKRYRDKVTYWMTHNE
ISNQTAISDDPIYQFLVWTNSGIRFDEQATLKHKQEAMVQAGHYELVASARAVKIGHEIN
PDFVIGGMANVAPFYPATPSPADMLAWQKARQARDWMMDVHVRGEYPSDMEKFFERSGFR
PDITDQDREDLKAGVVDYMAISYYNSTTVRAVSDKDAEMEDFGNFEIVKNDYIKTNDWDW
GIDPKGLRFTLNEMNELYPGLKIMIVENGIGAYDTIEADGTIHDPYRVDYLREHIREMEK
AVVLDGVDVIGFLSWGPIDIVSAGTGEMKKRYGYIYVDLDDMGEGSGQRLKKDSFYWYRE
VIASGGQTLD
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcaaaagaaacgtatcaattgaatcaagactttttatggggtggcgcgattgccgca
catcaggctgaaggcgcatggcaagctggcggcaaaggcgttagtatcgctgacgtgttg
accgctggtgcgcataatttaccacgccagattaccgatggtgtcgttgaagggttgaat
taccctaaccatcacgggattgaattttacgatacgtacaaagaagatttagccctcatg
gcagaaatgggatttaaagcctttcgaacgtcgattgcctggacgcgaattttccccaat
ggggatgatgccgaaccaaacgaagcgggtttggctttctatgatgacctatttgacgaa
atgcataaacacggcattgaaccagtgattacgttacagcattttgaaatgccttatcac
ttagttgaagcttatggtggctggtcaaatcgtcaagttattgatttgtttgtcagatat
gcggaagtggtgtttaagcgctaccgtgacaaggtgacctactggatgacacacaatgaa
atttccaaccaaacggctatttcagatgatccaatctatcaattcttagtttggacaaat
tcaggtattcgctttgatgaacaagcgacattgaaacataagcaagaagcgatggtgcaa
gccggacactacgagttagtggcttctgcacgggcggtcaagattgggcatgagattaat
ccagacttcgtgattggtggtatggccaatgtggcaccattctatcctgccacaccaagt
ccagcagatatgttggcttggcaaaaggcacgtcaggcccgtgattggatgatggatgtg
catgtgcgcggtgaatacccaagtgatatggaaaaattctttgaacgttcaggtttccga
ccagatattactgaccaagaccgtgaagacctgaaggcaggggtggttgattatatggcc
atttcctactacaactcgacaacggtccgcgccgtgtcggataaagatgccgaaatggaa
gacttcggtaactttgaaatcgtcaagaacgattacattaaaacgaatgattgggattgg
ggaattgacccaaaaggcttacgtttcaccttgaatgaaatgaacgaattgtatcctgga
ttaaagatcatgatcgttgaaaacgggattggggcttatgatacaatcgaagccgatggg
acaattcacgacccttatcgtgttgactatctccgtgagcacattcgtgaaatggaaaag
gcagttgtgctggatggcgttgacgtgattggtttcttatcatggggaccaattgatatt
gtgtcagctggtactggagaaatgaagaagcgttatggctacatttatgtcgatctcgac
gatatgggcgagggttcaggacaacgactcaaaaaagatagcttttattggtatcgcgaa
gtcattgcgagtggtggtcaaacactagactaa

DBGET integrated database retrieval system