KEGG   Leuconostoc garlicum: A9176_02125
Entry
A9176_02125       CDS       T04802                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00350  Tyrosine metabolism
lgc00620  Pyruvate metabolism
lgc00625  Chloroalkane and chloroalkene degradation
lgc00626  Naphthalene degradation
lgc00650  Butanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_02125
   00620 Pyruvate metabolism
    A9176_02125
   00650 Butanoate metabolism
    A9176_02125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9176_02125
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A9176_02125
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A9176_02125
   00626 Naphthalene degradation
    A9176_02125
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A9176_02125
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A9176_02125
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: AQN79259
LinkDB
Position
complement(435541..438243)
AA seq 900 aa
MVDANEKKPAKKALTPEEKAELQAQAEKMTAELVEKSQKALAEFSTYTQEQVDKIVAAMA
LAGSENSLLLAHEAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
VAAPLGVLAGIVPTTNPTSTTIFKAMLTAKTRNTIIFAFHPQAQKASAHAAKIVYEAAVK
AGAPKNFIQWIETPSIYATTALIQNPGIASILATGGPSMVNAALKSGNPSMGVGAGNGAV
YIDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPVYDEILQKLQEQGAYLVPKKDY
KKIADFVFKPNAEGFGVAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDRKNIGEALSSE
KLSPLLSLYKVDTREEAIDTVQALLDYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWIRL
PKEVYYEANAITYLQDLPSVKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETSIYGSVQ
PDPTLSQAVEIARQMADFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILSDEEGIKE
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAFESYVSVMASEFTRPWALEAIKLIFEN
LTTSYNYDPKNPTKEGQNARTKMHYASTLAGMSFANAFLGINHSLAHKIGGEFGLAHGLS
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDAELVESLIAAV
KDLAKSIDVDLTLSENGVTEATLMKSVDQLTDLVYNDQCTPGNPRQPSLAEIKQLLIDMI
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggtagacgcaaatgaaaagaagcctgcaaagaaggctttgacgccagaagaaaaggcg
gaattacaagcacaagctgaaaaaatgacagcagaattggttgaaaagtctcaaaaggct
ttggctgaattctcaacatatacacaagaacaagttgataagattgttgcagcaatggcc
ttggctggatcagaaaactcattgctattggcgcacgaagcacacgacgaaactggtcgt
ggggttgttgaagataaggatacaaagaaccgttttgcttcagaatctgtttataacgcc
atcaagtttgataagacagttggtgtgattagcgaagataaaatccaaggaaaggttgaa
gtcgctgcaccacttggggtattggctggtatcgtgccaacaactaacccaacgtcaaca
acaatttttaaggctatgttgacagcaaagacgcgtaacacgattatctttgctttccac
ccacaagcacaaaaggcttcagcacacgctgctaagattgtttatgaagcagcggtgaag
gctggcgcacctaagaacttcatccaatggattgaaacaccatcaatttatgcgacaaca
gccttgatccaaaaccctggtattgcctcaattttggctactggtggcccatcaatggtt
aacgcagccttgaagtcaggtaacccttcaatgggtgttggtgccggtaacggtgcggtt
tatatcgatgcaactgttgatacagaccgtgcggtatctgacttgttgttgtcaaagcgt
tttgacaacggtatgatctgtgccactgaaaactcagcggttatccaagcccctgtttat
gatgaaattttgcaaaagttgcaagaacaaggtgcttacttggtacctaagaaggactac
aagaagatcgctgacttcgtcttcaagccaaatgcagaaggctttggtgttgctggtcca
gttgctggtatgtcaggtcgttggattgctgaacaagctggtgttaagattcctgaaggt
aaggatgtcttgttgtttgaattagaccgcaagaacatcggtgaagccttgtcatcagaa
aagctttcaccattgttgtcactttataaggtcgacacacgtgaagaagctatcgacaca
gtacaagcactcttagactatcaaggtgccggacacaacgcggctattcaaatcggatca
caagatgatccatttattaaggaatatgctgatgctatcggtgcatcacgtatcttggtt
aaccaaccagattcaatcggtggtgtcggtgatatctatacagatgctatgcgcccatca
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttgtcaacatac
gatttgcttaatattaaaacagtggcgcgtcgtcgtaaccggccacagtggattcgtttg
ccaaaggaagtttactacgaagctaacgccatcacttatttgcaagatttgccatcagtt
aagcgtgccttcatcgtggccgatccaggtatggtacaattcggcttcgttggtaaggtt
ttgagtcaattagaattgcgtcaagaacaagttgaaacatcaatctatggctcagtacaa
ccagacccaacattgtcacaagcggttgaaattgcacgtcaaatggctgacttcaagcct
gatactgtcatcttgcttggtggtggttcagcacttgatgccggtaagattggtcgcttc
ttgtacgaatactcaacacgtcacgaaggtattttgtcagacgaagaaggtatcaaggaa
ttgttcatggaattgcaacaaaagttcatggacatccgtaagcgtatcgtgaagttctac
cacgcacgtttgacacaaatggttgccattccaacaacatcaggtactggttctgaagtg
acaccattcgccgttattacagacgatgaaacacacgtgaagtatccattggccgattac
gaattgacaccagaagtcgctattgtcgacccagaattcgtcatgactgtgccaaagcgt
acagttgccttctcaggattggatgctttgtcacacgcctttgaatcatatgtttcagta
atggcgtcagaattcacacgtccatgggctttggaagctatcaagttgatttttgaaaac
ttgacaacatcatacaactacgatccaaagaacccaacaaaggaaggtcaaaacgcacgt
acgaagatgcactatgcttcaacacttgctggtatgtcatttgccaacgccttccttggt
atcaaccactcacttgcacacaagatcggtggtgaattcggtttggctcacggtttgtca
atcgcgattgctatgccacacgtgattaagttcaatgctgtgacaggtaacgtgaagcgc
acaccatatcctcgctatgaaacatacacagcacaaaaggattacgctgatattgcccgc
taccttggcttgaagggtaacacagatgctgaattggtagaatcattgattgccgcagtg
aaggatttggctaagtcaattgacgttgacttgacattgtcagaaaacggcgttaccgaa
gctactttgatgaagagtgttgatcaattgacagaccttgtctacaacgatcagtgcacg
cctggtaacccacgccaaccaagcttggctgaaatcaagcaacttttgattgacatgatt
taa

DBGET integrated database retrieval system