KEGG   Leuconostoc garlicum: A9176_02140
Entry
A9176_02140       CDS       T04802                                 

Definition
(GenBank) acetoin reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_02140
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     A9176_02140
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     A9176_02140
    1.1.1.-  
     A9176_02140
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP Shikimate_DH F420_oxidored 3HCDH_N Epimerase NAD_binding_2 3Beta_HSD Gamma_PGA_hydro NmrA
Other DBs
NCBI-ProteinID: AQN79261
LinkDB
Position
complement(439949..440719)
AA seq 256 aa
MTKVALVTGAGQGIGQAIAERLVKDGFKVAVVGRHLDKVQKVADKINDNGGEAIAIQADV
AKRAEVFAAVAETKEKFGEFNVIVNNAGVAPTTPIMSVTEEDMNWTWGINVNGVVWGTQA
AADAFMSLGHGGKIINATSQAGVQGNPNLTAYGSTKFAIRGITQTTAKELAEFGITVNAF
APGIVKTPMMWDIAHEVGQNAGQDDEWGMAQFSDGITLGRLSEPEDVANVVSFLAGDDSN
YVTGQTIVVDGGMVFH
NT seq 771 nt   +upstreamnt  +downstreamnt
atgacgaaagtagcattagtaacaggcgctggacaaggtattggccaagcgattgcggaa
cgattggttaaagatggctttaaggttgccgtagttggccgtcatttagacaaagtacaa
aaagtagcggataagattaacgacaacggtggcgaagccattgcgattcaggcagacgta
gcaaaacgcgcggaagtttttgcagcagttgctgaaacaaaagaaaaatttggcgaattc
aatgttatcgtcaataacgcaggcgtggcaccaacaacgccaattatgtcggttactgaa
gaagatatgaactggacttgggggattaacgtgaatggtgtggtctgggggacacaagca
gccgcagatgcctttatgtcacttggacacggcggtaaaattattaacgcaacatctcaa
gctggcgtacaaggtaatcctaatttgacagcgtatggttcaacgaaatttgcaattcgt
ggtattacgcaaacgacagctaaggaattagctgaatttggtatcacggtgaatgctttt
gcgccaggtattgttaagacaccaatgatgtgggacattgcgcatgaagtcggtcaaaat
gctggtcaagatgatgaatggggaatggcacaattttctgatggaattacgcttggtcgt
ttgagtgaaccggaagatgttgctaatgtcgtgagtttcctagctggagacgattctaat
tatgtgactggacaaacaattgttgttgacggtggtatggtattccattaa

DBGET integrated database retrieval system