KEGG   Leuconostoc garlicum: A9176_02250
Entry
A9176_02250       CDS       T04802                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00040  Pentose and glucuronate interconversions
lgc00051  Fructose and mannose metabolism
lgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A9176_02250
   00051 Fructose and mannose metabolism
    A9176_02250
Enzymes [BR:lgc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A9176_02250
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AQN79280
LinkDB
Position
complement(456028..457374)
AA seq 448 aa
MSELFSFPKVTYVGNQSLTAGDGYHYYNADEVVAGKKMSEWLKFSVAYWHTMDQRLTDPF
GEGTAVRPWDNAGDGDEMAAALAKVDYMFEFLDKTGIEYFAFHDRDLAPEGKTLAETNAN
LDKVIDKIEQKMQETGKKVLWNTASLFTNKRFLAGGATTPFAEVFAYAAGQIKHSLDIAK
RLGSESYVFWGGREGYDFLLNTDTKRELDHIAAFFKLAKDYADEIGYTGQFLIEPKPKEP
TQHQYDFDVQTTIAFLKTYGLEDTFKLNLEGNHTYLAGHTYEHEVRFAREAGLLGSLDAN
MGDKLTGWDIDEFPNDIYEATLVMYEFLKNGGLPTGGLNFDSKPRRQSFEFEDLCYAHIA
GMDTYAAGLKVAAKLIEDQVIENILKERYASFDSGIGADFEAGKVTLKDLAAYAENKTDD
EINATLKSGRQEQIKATLNNYIFSVLGK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtcagaattgttttcatttccaaaagtgacttatgttggcaatcagtcacttacagct
ggtgatggctaccattactataacgctgatgaagttgttgccggcaagaagatgagtgaa
tggctcaagttttcagtggcttactggcacacaatggatcaacgtttgacggatccgttt
ggtgaaggcacagcagtacgcccatgggataatgcgggtgacggcgatgaaatggccgca
gcgttggcaaaagtcgactacatgttcgaatttttggacaagacaggtatcgaatatttt
gctttccacgatcgtgacttggcaccagaaggtaagacattagccgaaacaaatgcgaac
cttgacaaggtgatcgacaagattgaacaaaagatgcaagaaactggcaagaaggtgctt
tggaacacagcctcactcttcactaacaagcgtttcttggctggtggagcaaccacacca
tttgccgaagtctttgcttacgccgctggtcaaattaagcactcacttgatatcgctaag
cgtttgggttcagaatcttatgttttctggggtggtcgtgaaggttatgacttccttttg
aacacggatacaaagcgtgaattagaccacatcgctgccttcttcaagttggctaaggac
tatgctgatgaaattggctacacaggtcaattcttgattgaaccaaagccaaaggaacca
acacaacaccaatatgactttgatgtgcaaacaacgattgcgttcttaaagacgtatggc
ttggaagacacattcaagttaaacttggaaggtaaccacacttacttggctggtcatact
tatgaacacgaagtgcgctttgcacgcgaagctggtttgttgggatcacttgatgccaac
atgggtgacaagctcactggttgggatatcgatgaattcccaaatgacatttacgaagcc
acattggtcatgtatgaattcttgaagaatggtggtttgccaacaggtggtttgaacttc
gattcaaagccacgtcgtcaaagctttgaatttgaagatctctgctatgcacacattgct
ggtatggatacgtatgctgctggtttgaaggtggcagctaagttgatcgaagatcaagtc
atcgaaaacattttgaaggaacgctatgcctcatttgattcaggtatcggcgcagacttt
gaagctggtaaagtgacattgaaggatttggctgcctatgcggaaaacaagacagatgac
gaaatcaatgcaacattgaagtcaggtcgccaagaacaaattaaggccacattgaacaac
tacattttctcagtgttgggcaagtaa

DBGET integrated database retrieval system