KEGG   Leuconostoc garlicum: A9176_02895
Entry
A9176_02895       CDS       T04802                                 

Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00270  Cysteine and methionine metabolism
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_02895
   00620 Pyruvate metabolism
    A9176_02895
   00640 Propanoate metabolism
    A9176_02895
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A9176_02895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgc04147]
    A9176_02895
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     A9176_02895
Exosome [BR:lgc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   A9176_02895
  Exosomal proteins of breast milk
   A9176_02895
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored Sacchrp_dh_NADP UDPG_MGDP_dh_N 3HCDH_N TrkA_N ApbA NAD_binding_7 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AQN79384
LinkDB
Position
complement(575517..576431)
AA seq 304 aa
MRKIGVVGIGHVGATVAHLIVSQGLADTLVLVDKNPDKLASEVLDFRDAASLLPQHVTVT
AGTTADLGDADVVISALGHIDLIQPGGDRFTELRANTPEVQQVGTDLKHAGFQGVLIVIS
NPVDVMTGLYQQVTGLPTQQVFGTGTYLDTARLKRALGDALNIDPRSVSGYMLGEHGASQ
FAAWSTVRALGQTATELAATYQLDLNQIAADARDGGFTVFAGKKYTNFAIAHAAVALAQL
VLSDARQEAIVSHYDHQFDSYISTPAIIGRGGIVGDFSLALTAVEQASLKQSAAAIAEKT
AAYL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcgaaaaattggcgttgttgggattggtcacgttggtgcaacagttgcccatctgatt
gtgagccaaggtctcgcagatacattggtccttgttgataaaaaccctgataagttggca
tcagaagtacttgattttcgtgatgccgcgagtttattacctcaacacgtgacggtgaca
gccggtacaacggctgacttaggcgatgctgatgtcgttatttcagcactgggtcatatt
gacctcatccaacctggcggagatcgtttcacggaattacgcgccaatacaccagaagtg
caacaagtcggaactgacttaaaacatgcaggttttcagggggtcttaatcgtcatttcc
aatccagttgacgtgatgactggcctttaccaacaagtgaccggtttacccacccaacaa
gtttttggcacagggacttatttagacactgcccgtttgaaacgcgccctcggtgacgcc
ctgaatattgatccgcgcagtgtcagtggctatatgttaggcgaacatggggcgtcacaa
tttgccgcctggtcaaccgttcgggcacttggccaaaccgcaactgaactggccgctacc
taccagcttgatttgaatcaaattgccgctgatgcgcgcgatggtggctttactgtcttt
gctggtaaaaaatataccaacttcgccattgcccatgctgctgtggcattagcccaactt
gtgctgtcagatgcccgccaagaagcgattgtgtcccattacgaccaccaatttgacagc
tatatctcgacacccgctattattggtcgtggcggtattgtcggggatttttctttagcg
cttacggctgtcgaacaggccagcctcaagcaatctgccgctgccatcgccgaaaaaaca
gcggcctatctataa

DBGET integrated database retrieval system