KEGG   Leuconostoc garlicum: A9176_03540
Entry
A9176_03540       CDS       T04802                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00051  Fructose and mannose metabolism
lgc00562  Inositol phosphate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01230  Biosynthesis of amino acids
Module
lgc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_03540
   00051 Fructose and mannose metabolism
    A9176_03540
   00562 Inositol phosphate metabolism
    A9176_03540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgc04147]
    A9176_03540
Enzymes [BR:lgc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A9176_03540
Exosome [BR:lgc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A9176_03540
  Exosomal proteins of bladder cancer cells
   A9176_03540
  Exosomal proteins of melanoma cells
   A9176_03540
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-ProteinID: AQN80379
LinkDB
Position
677429..678241
AA seq 270 aa
MAKMHKSKRVPFVVANWKINKLQADVTDFLAQVNGKVPDQHVVETGIAAQDLFLADMVRA
TKETPVHVVAENVHWEDSGAYTGETSPKALKDIGATYVLIGHFERRKFFNETDSTVNLKV
TAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVDQIRNVTIAYEPTWAIG
SGEAASADQAQKAAHLIRQTLAKLYSPVIAEQVRILYGGSVTPHNAREIMRQKDIDGVLV
GTAALDPDNFLQLVDIARDPDVPEFDVEHV
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcgaagatgcacaagtcaaaacgcgtgccgtttgtggtcgcaaactggaagattaat
aagttgcaggccgacgtcacggactttttggcgcaagttaatggcaaggtgccggatcaa
catgttgttgaaacgggcattgcagcgcaagatttgtttttggcagatatggtgcgcgca
acgaaagaaacacccgttcatgttgtcgcggaaaatgtgcactgggaagacagtggggcc
tatactggcgaaacatcacccaaagcgttaaaagatattggggcaacttatgtcttgatt
ggtcattttgaacgtcggaagttcttcaacgaaacggattcgacggtgaacttgaaagtc
acggccgctttacgtaacggcttgcgaccaattattgacgtagatgaagatatgagtacg
tacgcgcagtttatggatgctgaaccctctgtggcgcaagtggcagcggcgcttgctggt
gtctcagttgatcaaattcggaatgtgacgattgcttatgaaccaacgtgggccattggc
tcaggtgaagcagccagtgcggatcaagcgcaaaaggctgcgcatttgattcgccaaact
ttggcgaagttgtattcaccggtgattgctgaacaagtccgtattttatatgggggttca
gtgacgccgcataatgcccgcgaaattatgcgacaaaaagatattgatggcgtgctggtt
gggacagcggcacttgatccagataatttcttacaattagttgatattgcgcgtgatcca
gatgtcccagaatttgatgttgaacatgtttaa

DBGET integrated database retrieval system