KEGG   Leuconostoc garlicum: A9176_03715
Entry
A9176_03715       CDS       T04802                                 

Definition
(GenBank) UDP-glucose 4-epimerase GalE
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00541  O-Antigen nucleotide sugar biosynthesis
lgc01100  Metabolic pathways
Module
lgc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_03715
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_03715
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A9176_03715
Enzymes [BR:lgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     A9176_03715
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NAD_binding_4 adh_short KR Sacchrp_dh_NADP adh_short_C2 TrkA_N LpxI_N NmrA NAD_binding_7 Semialdhyde_dh UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AQN79517
LinkDB
Position
712610..713602
AA seq 330 aa
MSVLVLGGAGYIGSHMVKTLVEAGRDVVVVDALFTGHRDAVHPDAKFYQVDIRDKAALSA
VFDQEDIEQVVHFAAFSIVPESVANPLKYFDNNTSGMVTLLEVMKDHDVKQIVFSSTAAT
YGNPVNIPIKETDPQNPINPYGESKLMMEKIMAWSEQADGVKWVALRYFNVAGAAEDGTI
GEDHQPETHLVPIILQAGLGQRDYIEMFGDDYNTPDGFNVRDYVHVLDLADAHMRALQYL
ADGNESNQFNLGSATGFSVKEMVEAAREATGVDIPAKIGPRRAGDPDILIANSDKARDVL
GWAPKYDNVQDIIKTAWNWHQSHPTGYNDK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtcagtattagtattaggtggcgccggctatatcgggtcacacatggtaaaaacactt
gttgaagcaggtcgtgacgtcgttgttgttgatgccctgtttactgggcatcgtgatgcc
gtccacccagacgctaagttttatcaagtcgatatccgcgataaggccgctttatcagct
gtctttgatcaagaagacattgaacaagtcgtgcattttgccgctttttcaattgtgccg
gaatcggttgctaatccattgaagtattttgataacaatacgagtggcatggtaacgttg
ctggaagtgatgaaggatcatgatgtgaagcagatcgtcttttcatcaacagcagccact
tatggtaacccagtcaacattccaattaaggaaacggatccacaaaaccctatcaaccct
tatggtgaatcaaagttaatgatggaaaagatcatggcttggtcagagcaagcggatggt
gtgaagtgggtggcattgcgttacttcaacgtggctggggctgctgaagatggtacgatt
ggtgaagatcaccaacctgaaacccaccttgtaccaattattttgcaagctggtttgggt
caacgcgactacattgaaatgtttggtgatgactacaacacgccagacgggttcaacgtt
cgcgactatgttcacgtgttagacttggcagatgctcacatgcgggccttgcaatatttg
gctgatggtaatgaatcgaaccaatttaacttaggctcagcaactggtttctcagttaag
gaaatggtggaagccgcgcgtgaagcaaccggtgttgatattccagccaaaattggccca
cgccgtgctggcgatcctgatattttgattgccaactcagataaggcacgtgatgtgttg
ggttgggcaccaaaatatgataatgtgcaagacattatcaagacagcttggaactggcac
caaagccatccaactggttacaacgacaaataa

DBGET integrated database retrieval system