KEGG   Leuconostoc garlicum: A9176_03930
Entry
A9176_03930       CDS       T04802                                 

Definition
(GenBank) mannose-6-phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00541  O-Antigen nucleotide sugar biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_03930
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_03930
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A9176_03930
Enzymes [BR:lgc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     A9176_03930
SSDB
Motif
Pfam: PMI_typeI Cupin_2 Cupin_3 AraC_binding CENP-C_C
Other DBs
NCBI-ProteinID: AQN79555
LinkDB
Position
755073..756053
AA seq 326 aa
MTILMLAPALQEKIWGGTKLATFGYQLPSNHVGEAWVISAHDNGVSKITQGEFAGQDLAQ
LWTERPELFGGHDPEQAFPLLAKILDAQENLSIQVHPNDKQSSENFGKTESWYILDATPD
AKLYYGHHAPTKAALKTMVDEREWSQLLRTIPVQKGDFFYVPAGTFHALGAGVLALEIQQ
SSDSTYRFYDFDRVDATTQQPRPLQIDAALSVTKAPHVDPILNQRTRLQDQTILTRLLTS
PKFTIDKLSVRGESHFNQHHDYELFNVIAGDLTLTAEGTTYHLKKGDNFIMLKDTGNYIL
SGQGEVIVSFVTPTSYREQELSYLDN
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacaatcctgatgttagcaccagctttacaggaaaaaatttggggtgggacaaaacta
gcgacgtttggctaccagttgccatccaaccacgtgggcgaggcctgggtaatttccgca
catgacaatggggtctcaaagattacgcaaggtgagtttgccgggcaagatttagctcag
ttgtggacagaacgaccagaattatttggtgggcatgatccagaacaggcatttccgcta
ttagccaaaattttagatgcccaggaaaacctatcgattcaggtacacccgaatgataag
caatcatccgagaactttggcaagacggaaagttggtatatcttagatgccacacctgac
gccaagttatattacgggcatcacgcgccgactaaagcagcgttaaaaacaatggttgac
gaacgtgaatggtcacagctactgcgcacaattccggtacaaaaaggggatttcttttat
gtgccggctgggacttttcatgccttgggtgctggtgtattagccttagaaattcaacaa
agttctgattcaacttatcgtttctatgactttgatcgtgtggatgcgacaacgcagcaa
ccacggccattacaaattgatgccgcactcagtgtgaccaaagcacctcacgtggatccg
attttgaaccagagaacgcggttgcaagatcaaacgattttaacgcgtttattgacatcg
cctaagttcaccattgataagttgtccgttcgtggggaaagtcatttcaaccagcaccat
gattacgaattgtttaatgtgattgctggtgacttaactttgacggctgaagggacgacc
tatcaccttaaaaaaggcgataattttatcatgttaaaggatactggcaactatatatta
tcgggccaaggtgaagtgattgtcagctttgtcacgccaacaagttatcgtgaacaagaa
ctctcatatctcgataattaa

DBGET integrated database retrieval system