KEGG   Leuconostoc garlicum: A9176_03935
Entry
A9176_03935       CDS       T04802                                 

Definition
(GenBank) PTS mannose transporter subunit EIIAB
  KO
K02794  mannose PTS system EIIAB component [EC:2.7.1.191]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_03935
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_03935
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_03935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_03935
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.191  protein-Npi-phosphohistidine---D-mannose phosphotransferase
     A9176_03935
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    A9176_03935
SSDB
Motif
Pfam: PTSIIB_sorb EIIA-man
Other DBs
NCBI-ProteinID: AQN79556
LinkDB
Position
756248..757210
AA seq 320 aa
MVNLIVASHGDFAKGIIMSGSMIFGEQENVEVVTFQPTEGPDDLDKHYQDALAKFDNDDD
TLFLVDLWGGSPFNRASLIQQQNPEHVAIVSGLNLPMLIEAYGGRLGMNSAADLAKYLVP
VSKDGIKSVPEAEEAKPAAPEKAEAKADATDGLKPGHININLARLDTRLLHGQVATAWTP
YSKANRIIVVSDAVAHDELRKNLIKQAAPNGVKANIVPISKMEEVAKDDRFGGVDALLLF
ETVQDVLRAVEGGVPIKTLNVGSMAHSEGKTMVNKVLSMDKADVEAFEKLRDLGVEFDVR
KVPSDSKANLFDLIKKANVQ
NT seq 963 nt   +upstreamnt  +downstreamnt
atggttaatcttattgttgctagtcatggtgactttgcaaaaggcattatcatgtcgggt
tcaatgattttcggtgaacaagaaaacgttgaagtcgtgacattccagccgactgaagga
ccagacgatttagataagcattatcaagatgccttggcaaagtttgataatgacgatgac
acattgttcttggttgatttatggggtggctcaccgtttaaccgtgccagcctcatccaa
caacaaaatccagaacacgttgcgatcgtatctgggttgaacttgccaatgttgattgaa
gcttacggcggccgtctaggcatgaattcagcagctgatttggcgaagtacttggtacca
gtctcaaaagacggtattaagtcagtgccagaagcagaagaagcaaagccagcagcgcca
gaaaaggcggaagctaaagctgacgcgactgatggtttgaagccaggtcacatcaacatc
aatttggcacgtttggatacacgtttgttgcacggtcaagtggcaacagcttggacgcca
tattcaaaggctaaccgtatcatcgttgtatctgacgcggttgcccatgatgaattgcgt
aagaacttaatcaagcaagcagcgccaaacggtgtgaaggctaacatcgtgccgatcagc
aagatggaagaagtagccaaggacgatcgtttcggtggcgttgatgcacttttgttgttt
gaaactgtgcaagacgtgcttcgtgccgttgaaggcggtgtgccaattaagacacttaat
gtcggttcaatggcgcattctgaaggtaaaacgatggtcaacaaggtcttatcaatggac
aaggcagacgttgaagcatttgaaaagttgcgcgacttgggtgttgaattcgacgtccgc
aaggtgccaagtgatagcaaggccaacttgtttgatttgattaaaaaagctaacgttcaa
taa

KEGG   Leuconostoc garlicum: A9176_03940
Entry
A9176_03940       CDS       T04802                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K02795  mannose PTS system EIIC component
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_03940
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_03940
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_03940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_03940
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    A9176_03940
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AQN79557
LinkDB
Position
757248..758057
AA seq 269 aa
MSIISMVLVVIIAFFAGMEGILDEFQIHQPLVSATLIGLVTGHLTAGIILGGSLQMIALG
WANIGAAVAPDVALASVASAIIMIKGNNFTPTGISVAVASAIPLAVAGLFLTMIVRTISV
GLTHGADAAAKDGNYRAIERYHLIGILLQGLRIAIPAALLIAIPASAVQNALAAMPEWLT
GGMAIGGGMVVAVGYALVINMMATREVWPFFAIGFALAAVSQLTLIALGAIGVALAFIYL
NLSKMGGNGGGGSNGNGSGDPVGDILDQY
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtctattatctcaatggttttagtcgtaatcattgccttcttcgcaggtatggaaggt
attttggatgaattccaaattcaccaaccattggtttcggcaacattaattggtttggtc
actggtcatttgactgcaggtattatccttggtggttcactgcaaatgattgcccttggt
tgggctaacatcggtgccgctgtggcaccggacgtggccttggcttctgtcgcttcagca
attatcatgattaagggtaacaacttcacgccaacaggtatctctgtggccgttgcttca
gctattcctttggctgttgctggtttgttcttgacaatgatcgtgcgtaccatttctgtt
ggtttgacgcacggtgccgatgcggctgctaaagatggtaactatcgggcaattgaacgt
taccacttgattggtatcttgttgcaaggtttgcgtattgcgatcccagctgctttgttg
attgcaatccccgcatcagccgttcaaaacgctttggctgcaatgccagaatggttgact
ggtggtatggctatcggtggtggtatggttgtcgccgttggttatgcattggttatcaac
atgatggcaacacgcgaagtatggccattcttcgcaattggttttgccttggccgctgtg
agccaattgacattgatcgcccttggtgcaatcggtgtggcattggccttcatctacctt
aacctatcaaagatgggtggtaacggtggcggtggttcaaatggtaacggctcgggtgac
ccagtcggtgacattttggatcaatactag

KEGG   Leuconostoc garlicum: A9176_03945
Entry
A9176_03945       CDS       T04802                                 

Definition
(GenBank) PTS mannose family transporter subunit IID
  KO
K02796  mannose PTS system EIID component
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00051  Fructose and mannose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9176_03945
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_03945
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_03945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_03945
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    A9176_03945
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AQN80382
LinkDB
Position
758072..758983
AA seq 303 aa
MAEKIELSRNDRLSVAWRSQFLQGSWNYERMQNVGWAYALIPAIKKLYTTKEDRVAALKR
HLEFFNTHPYVASPIIGVTLALEEERANGAAIDDTAIQGVKIGMMGPLAGIGDPVFWFTL
RPILGALGASLALSGNILGPILFFVLWNLIRMSFIWYTQEFGYKAGSAITQDLSGGLLKD
ITKGASILGMFILAVLVERWVSIKFVVNLPAKKLAEGAYIDFPSGAVTGGKLQQILSDQA
AGLSLTKMAPNTLQANLDSLVPGLMGLALTFFAMWLLKKNVSPIAMIVGIFVFGIIMHAL
HIM
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctgaaaaaattgaattatcacgtaacgatcgtctatctgttgcatggcgatcacag
ttcttacaaggttcatggaactacgaacgtatgcaaaacgtgggttgggcttatgccttg
atcccagcaattaagaagttatataccacaaaagaagatcgagtagccgctttgaagcgt
cacttggaattctttaacacacacccttatgttgcatcaccaatcattggtgtgacattg
gcattggaagaagaacgtgccaatggggctgcaattgatgacacagccattcaaggtgtg
aagattggtatgatgggacctttggctggtatcggtgatccggtcttctggttcacattg
cgtccaatcttgggtgctttgggtgcctcattggccctttctggtaacattcttggccca
atcttgttcttcgttttgtggaacttgattcgtatgtcatttatctggtatacccaagaa
ttcggttacaaggccggttctgcaattacacaagatttgtcaggtggtctcttgaaggac
atcactaagggtgcgtcaatcctgggaatgtttatcttggccgttctggttgagcgttgg
gtttcaatcaagtttgtcgttaacctaccagctaagaagttggctgaaggggcttacatt
gatttcccaagtggcgctgtgactggtggtaagttgcaacaaatcttgagtgatcaagct
gctggtttgtcattgacaaagatggcaccaaacacattgcaagcaaacttggatagtttg
gttcctggtttgatgggattggcattgacattcttcgctatgtggttgttgaagaagaac
gtatcaccaattgcaatgattgttggtatcttcgtcttcggaatcatcatgcatgccttg
cacatcatgtaa

DBGET integrated database retrieval system