KEGG   Leuconostoc garlicum: A9176_04390
Entry
A9176_04390       CDS       T04802                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00290  Valine, leucine and isoleucine biosynthesis
lgc00650  Butanoate metabolism
lgc00660  C5-Branched dibasic acid metabolism
lgc00770  Pantothenate and CoA biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01210  2-Oxocarboxylic acid metabolism
lgc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_04390
   00660 C5-Branched dibasic acid metabolism
    A9176_04390
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    A9176_04390
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A9176_04390
Enzymes [BR:lgc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     A9176_04390
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Sigma54_activ_2
Other DBs
NCBI-ProteinID: AQN79633
LinkDB
Position
852342..854027
AA seq 561 aa
MSDQKYGADIVADSLTNHGIDLVFGIPGAKIDRLFTTLEHPAPGQKVPKLIVTRHEQNAV
FMAQAFARITGKPGVTIVTSGPGVGNLVSGLMTASAESDPVVAIGGQVPRKDLYRLTHQS
TNSVALFAPITNYSSEIQDPNNISEIIANAFAAANGAKKGAAFVSLPQDVDDAPVSVEAL
PPMPYAKQGAAALADLDWLAEQIKQAKLPVLLVGARGSDDDTVAALHKLLKQTTLPVVET
FQGSGVISRELEPETFFGRIGFFRNQTGDKLLKQSDLVITVGYDAIEYEPRNWNKENDLN
IVALDTTPVQIDNNFVPKRQLVGDLGQSLDLLTERVAGYELPVDSRAVLKTLKADLRASD
EPTYTPAQGHLNHPLNIIKAIQAHVTDDMTVATDIGSHYIWMARHFKSYVARHFLISNGM
QTLGVGLPWAMTAAMLRPNAKAVSVSGDGGFFFSSMELETAVRLKLNTVHIVWNDNAHYD
MVKFQEEMKYDGRSAGVDFGNIDLVKYAESFGAKGLRVNTPDELNAVLDEAFASEGPVVV
DIPVDYSHNFELGSQMIDAQG
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtcagatcaaaagtacggtgcagatattgttgcagatagcttgacgaaccatggaatt
gatttggttttcgggattcccggtgccaagattgatcgtctctttacgacgttggaacat
ccagcccctggtcaaaaagtgccaaaattaattgtgacgcgtcacgaacaaaatgcggtc
tttatggcacaagcttttgcgcgtattaccggtaagccaggtgtcacaattgtcacatca
ggtcctggtgtgggtaacttggtgagtggtttgatgacagcaagtgctgaaagcgaccct
gtagttgcgattggtggtcaagtaccacgtaaagacttgtatcgtttgacgcaccaatca
acgaattcagtggcactgtttgccccaattacgaattatagttcggaaattcaagatcca
aataacatttcagaaattattgcgaacgcttttgcggctgctaatggcgctaaaaaaggg
gcagcctttgtttcattgccacaagatgtggatgatgcccccgtgtcagttgaagctttg
ccaccaatgccttatgccaagcaaggggcagcagccttagctgatttggattggttagct
gaacaaatcaagcaagctaagttgccagttttgttggttggcgcgcgtggttctgacgat
gatacggttgccgctttgcacaagttgttgaagcaaacgacactgccagtcgtagaaaca
ttccaaggttcaggcgttatttctcgtgaattggaaccagaaacattctttggccgtatt
ggcttcttccgtaaccaaacaggggacaagttgttgaagcaatctgacttggtcatcacg
gttggttatgatgcgattgaatacgaaccacgtaactggaataaagaaaatgatttgaac
attgtggcgttggatacaacaccagtccaaatcgacaataactttgtgccaaagcgtcaa
cttgtgggtgacttgggtcaaagcttagacttattaacagaacgtgtggctggttatgaa
ttacctgtggatagtcgagccgttttgaagacattgaaggcggatttgcgcgcgtcagac
gaaccaacttacacgccagcgcaaggtcatttgaaccacccattaaacatcatcaaagcg
attcaagcgcatgtgacggatgatatgactgtggcaactgatattggctcacactacatc
tggatggcgcgtcacttcaagtcatacgttgcccgtcacttcttgatttcaaatggtatg
caaacgcttggtgttggtttgccatgggcaatgacagcagcgatgttgcgtccaaatgcc
aaggcagtgtcggtttctggtgatggtggtttcttcttctcatcaatggaattagaaaca
gctgttcgtttgaagttgaacaccgtgcatattgtgtggaatgacaacgcccactatgac
atggtcaagttccaagaagaaatgaagtatgacggtcgctcagccggtgttgattttggg
aacatcgacttggtgaagtatgctgaaagttttggcgcaaagggattgcgtgtcaacaca
ccagatgaattgaatgcggtacttgatgaagcctttgcatctgaaggcccagtagtggtg
gacatcccagttgactactcacataactttgaattagggtcacaaatgattgatgcccaa
ggctaa

DBGET integrated database retrieval system