KEGG   Leuconostoc garlicum: A9176_04535
Entry
A9176_04535       CDS       T04802                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00020  Citrate cycle (TCA cycle)
lgc00620  Pyruvate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_04535
   00020 Citrate cycle (TCA cycle)
    A9176_04535
   00620 Pyruvate metabolism
    A9176_04535
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     A9176_04535
SSDB
Motif
Pfam: E1_dh DXP_synthase_N Hema_esterase
Other DBs
NCBI-ProteinID: AQN79657
LinkDB
Position
879071..880207
AA seq 378 aa
MSDITVTNEKILDFSGQLALQDETFPTLQILNPAGEIVDEAGLARADLSSEDLVQIMQRM
LLSRQLDIRSTKLAKQGRFGFFAPTAGQEASQMASSYAFNDNDWLMPGYRDIPQIIVKGW
PIWKAILWSRGHVLGNVFTTADEQPVNAWMPQIIIGAQYVEAAGIGLGLKKRQKDAVAYA
YTGDGGSSQGDFYEGVNFAGAYQANAVFFIQNNGYAISTPRGLQTAATHLAAKGWAAGVP
SVVVDGNDPIAVYLAAKEARQWAVSGNGPVLIETLTDRLEPHSTAGDDPLRYRTQDDIDA
WWAKEPLIRMRQFMTDQGIWDEAKETAYIAEVNALIDEQIKIADNVPKQKISDFIKNTLE
VPSYAMTEQIAKFESEGK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtctgatatcacagtaacaaatgagaaaattttggactttagtggccaattagcgcta
caggatgagacatttccaacgctgcagattttaaatcctgcgggtgagattgttgatgaa
gctggtttagcgcgtgcagacctgtcatcggaagacttagtccaaatcatgcagcggatg
ttgttgagccgacagttggatattcggtcaaccaagcttgctaaacaagggcgctttggc
ttctttgcgccaacagctggccaagaagcctcacaaatggcatcttcttatgcctttaat
gataatgattggcttatgccaggttatcgtgatattccacaaattattgtgaaagggtgg
ccgatttggaaagcgattctttggtcacgtggtcatgtattaggtaatgtgttcacaacg
gcagatgagcaacccgtcaatgcttggatgccacaaattattatcggcgcgcaatacgtt
gaagcagctggaattggtttaggtctcaaaaagcgacaaaaagacgcggtcgcctatgcc
tatacgggtgatggcggttcgtcacaaggtgacttttacgaaggggtcaattttgctggc
gcctatcaagccaatgccgtcttctttattcaaaataatggctacgccatttcaacacca
cgtgggttacaaacggcagccacccatttggcggccaaaggttgggctgctggggtaccg
agtgtcgtggttgatgggaatgatccaattgccgtgtatttggcggctaaggaggcgcgt
cagtgggcagtatcaggtaatgggccagtcttgattgaaacgctgacagatcgcttagag
ccgcattcaactgcgggtgacgatccattgcgttatcggacacaagatgacattgatgct
tggtgggcaaaagaaccactcattcggatgcgccaatttatgaccgatcaaggcatttgg
gatgaggctaaggaaacggcctatattgcggaagtcaatgctttaattgatgagcaaatt
aagattgcagataatgtgccaaagcaaaagatttctgattttattaaaaatacacttgaa
gtcccaagctatgccatgacggaacaaatcgcaaagtttgaaagtgagggaaagtaa

KEGG   Leuconostoc garlicum: A9176_04540
Entry
A9176_04540       CDS       T04802                                 

Definition
(GenBank) 2-oxoisovalerate dehydrogenase
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00020  Citrate cycle (TCA cycle)
lgc00620  Pyruvate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_04540
   00020 Citrate cycle (TCA cycle)
    A9176_04540
   00620 Pyruvate metabolism
    A9176_04540
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     A9176_04540
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-ProteinID: AQN79658
LinkDB
Position
880209..881189
AA seq 326 aa
MAIKSYIDAVREAMDLALGQDENVLIFGEDVGKNGGVFRATDGLQAKYGEDRVFNTPLAE
SGIGGLAIGLTTQNYRPVMEIQFFGFVFEVMDSIAGQMARNRFRFGGTKQMPIVVRAPYG
GGTKTPEMHADNLEGIVAQIPGIRVVMPANPADAKGLLLSAIESNDPVVFLENLHLYRSL
KGEVPEGYYTTPLDQAAIAREGTDVSIISYGGGVPVALKAAEALAKDNISAEVLDLRTVS
PLDIASIGTTVQKTGRVVVVQEAQRMAGIGANVMSEISERFILNLKAPIGRVAAPDSVYP
FGQAENDWMIKADDVVAKVMEVVNYD
NT seq 981 nt   +upstreamnt  +downstreamnt
atggctattaaaagttatattgatgctgtccgtgaggcaatggatcttgcccttggtcaa
gacgagaacgtcctcatttttggtgaagatgttggaaaaaatggtggggtgttccgagcc
acggatggtttgcaagccaaatacggcgaagatcgggtgtttaacacgcctttagctgaa
tcagggattggtggtcttgccattggcttaaccacacaaaattatcgcccagtgatggaa
attcaattctttggttttgtgtttgaagtgatggattcaattgctggacaaatggctcgt
aatcgtttccgttttggtgggacaaagcaaatgccaattgtggttcgtgcaccttatggc
ggtggtacgaagacaccagaaatgcacgcggataatctcgaagggattgtggcccaaatt
cctgggattcgggtcgtgatgccggctaacccagcagatgctaaaggcctactgctcagt
gcaatcgaatccaatgatcccgtggtctttttggaaaatctgcacctttaccgttcatta
aagggcgaggtgccagaaggttactacacgacgccacttgatcaggccgcaattgcgcgt
gaggggactgatgtgtcaatcatttcttacggtggcggggtaccagtcgcactgaaggcg
gcggaagccctagcaaaagacaatatttcagccgaagttctagatttacggaccgtttcg
ccgctagatattgcaagtattggtaccacagtccaaaaaactggtcgcgtggtcgttgtc
caagaagcgcaacggatggctggtattggcgccaacgtcatgagtgaaatttcagaacga
ttcatcttgaatttgaaagcgccaattggtcgggtggcggcaccggactccgtttaccca
tttggtcaagctgaaaatgattggatgattaaagcagatgatgtcgtggccaaagtgatg
gaggttgtgaattatgactga

DBGET integrated database retrieval system