KEGG   Leuconostoc garlicum: A9176_04545
Entry
A9176_04545       CDS       T04802                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00020  Citrate cycle (TCA cycle)
lgc00620  Pyruvate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_04545
   00020 Citrate cycle (TCA cycle)
    A9176_04545
   00620 Pyruvate metabolism
    A9176_04545
Enzymes [BR:lgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9176_04545
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Other DBs
NCBI-ProteinID: AQN79659
LinkDB
Position
881182..882489
AA seq 435 aa
MTEIFKMPDIGEGMAEGDITLWLVKVGDTVAMDDPVAEVQNDKLIQEILSPYAGKVTKLF
VEAGATVSVGDSLIEFDGDGSGGAASGATTATSESAPEMASVAPEPEPTRSTPEPATSTV
QTVNGHVLAMPSVRHLAFEKGIDLTQVPATGRHGHVTLTDVMNFQADTTAAPTPVAAVAP
AATTPPKPADNKPERPVASAPLHEGRQPMTPIRKVIAKAMANQNATIPAVTNFDSVEVSQ
LVAHRQQFKAQAAEQGIHLTYLSYVVKALAATAKKFPEINASLDMTTQEIVYHDEVNMGI
AVNAPSGLFVPVVAQADRKSIFQIAKEIAILADAVRDGSISPKQMQGSTMTISNLGSARG
TWFTPIINGHEVMILGLGSIVKEPVVNAAGEIVVGQNMKLSLTYDHRLIDGMLGQSALNY
LKQLLADPAYMLMEV
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgactgagatttttaaaatgccagatattggtgaagggatggccgaaggcgatattacg
ttatggctggttaaagttggcgacacggttgccatggatgatcccgttgccgaagtgcaa
aatgataagttaattcaagaaattttatcaccctatgcggggaaagtcaccaagttattt
gtcgaggcgggggcaactgtatccgtcggcgattcattgattgaatttgatggggatggc
agtgggggcgctgcgtcaggtgctactactgcaacatcagaatcagcacctgaaatggca
tcggttgcacctgaacctgagccaacacggtcgacacccgaacctgctaccagcacggtt
cagacggtgaatgggcacgtcttggcgatgccttcagttcgtcatttggcgtttgaaaaa
ggcattgatctcacgcaagtaccagccactggccggcacggtcatgtgaccttgaccgat
gtcatgaacttccaagcagataccacagcagcgcccacaccggtggctgctgtggcccca
gcggcaacaaccccaccaaagcctgcagataacaagccagaacgacctgttgcatcagcg
ccattacatgaaggtcggcaaccaatgacaccaatccggaaggtcattgccaaagcaatg
gccaaccagaacgcaacgattccggcggtcactaattttgatagtgttgaggtgagtcag
ttggtggcacatcgtcaacagtttaaagcacaggcggctgaacaagggattcatttgact
tacttgtcttatgtggtcaaagcgttggcggcgacggctaaaaaattcccagaaattaat
gccagtttggatatgaccacccaagaaattgtttaccatgatgaggttaacatggggatt
gcggtgaatgcaccgtctggtttatttgtaccagtcgtggcgcaagctgaccggaagtcg
attttccaaattgccaaagaaattgccatcttggccgatgccgtgcgtgatgggtcgatt
tcgcctaagcaaatgcaaggcagcacgatgacgatttctaacctcggttcagcacggggc
acttggttcacacccattattaatggccatgaagtgatgattcttggcttaggctcaatt
gttaaggagccagtcgtcaatgcggctggggagattgttgtcggtcagaatatgaagctg
tccttaacttatgatcaccggttgattgatggtatgttaggtcaaagtgccttgaattat
ttgaagcagttattggccgatccagcgtatatgttgatggaggtgtaa

DBGET integrated database retrieval system