KEGG   Leuconostoc garlicum: A9176_04670
Entry
A9176_04670       CDS       T04802                                 

Definition
(GenBank) alpha-acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00650  Butanoate metabolism
lgc00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_04670
   00660 C5-Branched dibasic acid metabolism
    A9176_04670
Enzymes [BR:lgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     A9176_04670
SSDB
Motif
Pfam: AAL_decarboxy
Other DBs
NCBI-ProteinID: AQN79681
LinkDB
Position
904986..905699
AA seq 237 aa
MSRLYQHGTLAMLMGKQMQGTITVAELRQHGDTGIGTLTGLDGEVILLDGEVYQAQSDGQ
VNHITNPDTLMPFASVHFDAPTQQLPFSQVDFSTLSAKLKAEQLQNVFAAVKFHGEFSRV
HVRIAPKQVPPYPSLLAVAENQPEFERENVTGTVVGYFAPQIFNGPTAAGWHVHFLSDDL
QFAGHILDFSASQISGTLQVFDEFLQHLPIHDPAYREMTLDFDGLLAGIAASEGGQQ
NT seq 714 nt   +upstreamnt  +downstreamnt
atgagtcgtttatatcagcacggaacattggcaatgctcatgggcaaacaaatgcaaggc
acgattacagttgctgaattgcgacaacatggcgataccggcattggcactttgacaggc
ttagatggtgaagtcattttgttagatggcgaagtctatcaagcgcaaagtgatggacaa
gttaaccacattacgaacccagatacgttgatgccgtttgcttcggtacattttgatgcg
ccgacgcaacaattaccgttttcacaagttgatttttcaacgttaagtgcaaaactaaaa
gcagaacagttacaaaatgtgtttgcggcagtaaagtttcacggtgaattttctcgtgtg
catgtacgcattgcgcctaaacaggtcccaccatacccaagtttgttggccgttgcggaa
aaccaaccggaatttgaacgtgaaaacgtgacaggtacggttgtgggttattttgcgccg
caaatttttaatggcccaacagccgccggttggcacgtgcatttcttgtcagatgatttg
caatttgccggtcatattttagatttttcagcaagccaaatctcagggacgctgcaagta
tttgatgagtttttacaacatctaccaattcatgatccggcataccgtgagatgacgctt
gattttgatggcttactagccggaattgcagcgagtgaaggagggcaacaataa

DBGET integrated database retrieval system