KEGG   Leuconostoc garlicum: A9176_04990
Entry
A9176_04990       CDS       T04802                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00030  Pentose phosphate pathway
lgc00040  Pentose and glucuronate interconversions
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A9176_04990
   00040 Pentose and glucuronate interconversions
    A9176_04990
Enzymes [BR:lgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     A9176_04990
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth FMN_dh B12-binding
Other DBs
NCBI-ProteinID: AQN79742
LinkDB
Position
976911..977567
AA seq 218 aa
MSGIIAPSILSADYTNLERDVKLVEAAGAEYLHIDVMDGNFVPSISYGPNWVKQLRPETD
MVLDVHLMVTNPEKIVDEFADAGADIIGVHVEATPHIHRALQMIKNKGVKAEVVINPGTP
VLAIEPVLDMVDQVLVMTVNPGFGGQKFLPSTLEKIAQLRAVRDELGYDFDIQVDGGIND
ETVVAAYEAGANVFVAGSYVYDKVDPAAKIARLKALTK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtcaggaattattgcgccatcaattttaagcgcagactataccaatttggaacgtgat
gttaagctcgttgaagcagcgggtgctgaatatttacacattgacgtcatggatggtaac
tttgtgccatcaatctcttacggaccaaactgggtcaagcaactccgtccagagactgat
atggtcttagatgtacatttgatggtgacgaatcccgaaaaaatcgttgatgaatttgcc
gatgccggtgccgatatcatcggggtgcatgttgaagcaacaccacacattcaccgtgcc
ctacaaatgattaagaacaagggcgttaaggctgaagttgtcattaacccaggaacaccc
gttctagccattgaaccagttttggatatggttgatcaagtattggtcatgactgtaaac
ccaggttttgggggacaaaagttcttgccatcaacacttgaaaagattgcccaattgcgt
gcagtgcgtgatgaattaggttatgactttgatatccaagttgatggtggtatcaacgat
gaaaccgttgtggcggcctatgaagcaggggctaatgtttttgttgcaggttcttatgtt
tatgataaagtggatccagctgccaaaattgcccgtttgaaagccttgacaaaataa

DBGET integrated database retrieval system