KEGG   Leuconostoc garlicum: A9176_05175
Entry
A9176_05175       CDS       T04802                                 

Definition
(GenBank) phosphate acetyltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00430  Taurine and hypotaurine metabolism
lgc00620  Pyruvate metabolism
lgc00640  Propanoate metabolism
lgc00680  Methane metabolism
lgc01100  Metabolic pathways
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_05175
   00640 Propanoate metabolism
    A9176_05175
  09102 Energy metabolism
   00680 Methane metabolism
    A9176_05175
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A9176_05175
Enzymes [BR:lgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     A9176_05175
SSDB
Motif
Pfam: PTA_PTB BOF Glucosamine_iso
Other DBs
NCBI-ProteinID: AQN79774
LinkDB
Position
1010357..1011346
AA seq 329 aa
MVELFEQLKSKINGQNKTIVFPEGEDVRIQGAAARLAAEGLIKPILLGDERVIATTASEN
NFDLSGVEIIDPLQYDADALAELNAALVARRKGKTDAETAAKWLRDVNYFGTMLVYTGKA
DGMVSGATHPTGDTVRPALQIIKTAPGSSRISGAFIMQKGDERYVFSDAAINIDVDAETM
AEIAVQSAQTAKVFDIEPKVAMLSFSTKGSAKSPMVDKVVEATKLAKEMAPELADQIDGE
LQFDAAFVPSVGAAKAPDSQVAGQANTFIFPSLEAGNIGYKIAQRLGGFEAIGPILQGLD
KPVSDLSRGANEEDVYKVAIITAAQAMAQ
NT seq 990 nt   +upstreamnt  +downstreamnt
gtggttgaattattcgaacaattaaaaagtaagattaacggtcaaaataaaacaattgtt
ttccctgaaggggaagatgtccgtattcaaggtgctgcggcgcgtttagcagcggaaggt
ttgattaagccaattttgttaggcgatgaacgtgtcattgcgacaaccgcttcagaaaat
aactttgatttatcaggtgttgaaatcattgatccattgcaatatgatgctgacgcatta
gcagaattaaatgctgctttggttgcacgtcgtaagggtaagactgatgctgagacagcc
gccaagtggttacgtgacgtgaactattttgggacaatgttggtttacacaggtaaggca
gatggtatggtgtctggtgcgacgcatccaactggtgatactgtacgaccagcgttgcaa
attattaaaacagcaccgggatcatcacgtatttctggcgcattcatcatgcaaaagggt
gatgaacgttatgtcttctctgatgctgctatcaatattgatgttgatgcagaaacgatg
gcagaaattgcggtgcaatctgcgcaaacagctaaggtatttgacattgaacctaaagtg
gcgatgttatcattttcaacaaagggttcagccaagtcaccaatggtagataaggttgtt
gaagccacgaagttagccaaggaaatggcaccagaattagcagaccaaattgatggtgaa
ttgcaattcgatgcagcgtttgtcccatcagttggtgcggcaaaagcacctgattctcaa
gtcgcaggtcaagccaatacctttattttcccaagcttagaagctggtaatattggttat
aagattgcccaacgtttgggtggtttcgaagcaatcggcccaatcttacaaggtttggat
aagccagtgtcagatttgtcacgtggtgccaacgaagaagatgtttataaggtggccatc
attacagctgcacaagcgatggcacaataa

DBGET integrated database retrieval system