KEGG   Leuconostoc garlicum: A9176_05730
Entry
A9176_05730       CDS       T04802                                 

Definition
(GenBank) maltose phosphorylase
  KO
K00691  maltose phosphorylase [EC:2.4.1.8]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_05730
Enzymes [BR:lgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.8  maltose phosphorylase
     A9176_05730
SSDB
Motif
Pfam: Glyco_hydro_65m Glyco_hydro_65N Glyco_hydro_65C Glyco_hyd_65N_2
Other DBs
NCBI-ProteinID: AQN79876
LinkDB
Position
1127481..1129748
AA seq 755 aa
MKRIFEVNPWTVTTHELNPQDKRLQESMTSLGNEYMGMRGMFEEVYSGDTHQGIYIGGVW
FPDKTRVGWWKNGYPHYFGKAINALNFVKADFYIDGQQVDLAKNDVQDFELSLDMQKGVL
NRTFTVFGVKVTVTRLISVAQKELAVLHYTFASADGQAHQVRFDASIDADVVNEDSNYDE
KFWQVLSAGHENDASFIATQTVENPFGVPQFTVVARQSFVGGDNQTTSQTATEVTDHFEL
TVPAAGEVTFEKRVVVTTSRDYADLDAVVAAGAEITQAIAGQSYDDLYTAHTQEWANRWE
KADVQIEGDDAAQQGIRFNLFQLFSTYYGNDPRLNIGPKGFTGEKYGGATYWDTEAFAIP
VYLGVAEPEVTRSLLQYRFDQLDGAFHNAKEQGLAGALYPMVTFDGIESHNEWEITFEEI
HRNSTIAYAIYNYTNITGDRSWLTGDGAQVLYNIARFWADRVHYSERHGQYMIHGVTGPN
EYENNVNNNFYTNWMAKWVLQYALDNYDDIADDQKARLNVSADELAKWQDIVAKMYLPEA
DITLKGKDYHIFEQHDTFLDKDLTPIADMPQDIRPINQNWSWDRILRSPYIKQSDTLHAM
FYFPDAFTEDEKRQNFEFYEPLTVHESSLSPSVHAILAADLEMSDKAVEMYERAARLDLD
NYNNDTEDGLHITAMTGSWLAIVQGFAGMRVRDGQLHLKPFLPKKWDKYSFRLVFRGHVL
EVSVDQTGANVQLISGDPLTINLSGEEVTLSKSDK
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgaaaagaatttttgaagttaatccctggacagtcacaacccacgaattgaatccacaa
gacaagcgtcttcaggaatcaatgaccagtttgggaaatgaatatatgggcatgcgtggc
atgtttgaagaagtgtattcaggtgatacgcaccaaggtatttatatcggtggtgtctgg
ttccccgacaaaacacgtgttggttggtggaagaatggttatccacactacttcggtaag
gcaattaatgctttgaattttgttaaagcagatttctatatcgatggccaacaagtggac
ttggcgaaaaatgatgttcaagactttgagttgtcattggatatgcaaaagggtgtctta
aaccgtacctttacggtatttggtgtcaaagtgacggtaacccgtttgatttcagtcgca
caaaaggaattagccgtcttgcattacacgtttgcctcagcggatggtcaagcccatcaa
gtgcgctttgacgcaagtattgatgcagatgttgtcaatgaagattcaaactatgatgaa
aagttctggcaagtgttgtcagctggtcatgaaaatgacgcctcatttattgccacacaa
acggttgaaaatccatttggtgtgccacaatttacagtcgtagcgcgtcaaagctttgtc
ggtggtgacaaccaaacgacctcacaaacagcaaccgaagtgactgatcactttgagttg
acggtgccagcagctggcgaagtgacatttgaaaagcgtgttgtcgtgacaacatcacgt
gattatgcggatttggatgccgtggtcgctgcaggtgctgaaatcacgcaagcgattgca
ggacaaagctatgatgacttgtatacagcacacacccaagaatgggctaaccgttgggaa
aaggccgatgttcaaattgaaggggacgatgccgcccaacaaggtattcgcttcaatctc
ttccaattgttctcaacttactacggtaacgatccacgcttgaacattggaccaaagggc
ttcactggcgaaaagtatggtggggcaacgtactgggatacggaagcgtttgccatccca
gtttaccttggggttgctgaacctgaagtgacacgatcattgttgcaataccgttttgat
caacttgatggtgctttccataacgctaaggaacaaggcctagcaggtgctttgtatcca
atggtaacctttgatggcattgaatcacacaacgaatgggaaattacgtttgaagaaatt
caccgtaattcaacgattgcttatgcaatttataactacactaacattaccggcgaccgt
tcatggttgacaggtgatggggcgcaagttttgtacaacattgcgcgcttctgggctgat
cgtgtgcactattctgaacgtcacggccaatacatgattcatggtgtcacgggaccaaac
gaatacgaaaacaacgtcaacaacaacttctacaccaactggatggccaagtgggtcttg
cagtatgcgttggataactacgatgacattgcagatgatcaaaaggcacgtttgaatgtg
tcagctgacgaacttgcaaagtggcaagacattgtggctaagatgtatttgccagaagca
gatatcacgctgaagggcaaggactaccatatctttgaacaacacgatacgttcttggat
aaggatttgacaccaattgctgatatgccacaagatattcgcccaattaaccaaaactgg
tcatgggatcgcatcttgcgctcaccatatattaagcaatcagacacattgcatgcgatg
ttctacttcccagatgcctttactgaagatgaaaagcgtcaaaactttgaattctacgaa
ccattgacagtgcatgaatcatcattgtcaccatctgttcacgccattttggctgctgat
cttgaaatgtcagataaggccgttgaaatgtatgagcgtgcggcccgtttggatttggat
aactataacaacgatacagaagatggccttcatattacagcgatgacaggttcatggttg
gcgattgtccaaggctttgctggcatgcgtgttcgtgatggtcaactgcacttgaagcca
ttcttgccaaagaagtgggacaagtacagcttccgtttggtcttccgtggtcatgtcttg
gaagtatcagttgaccaaactggtgccaatgtgcaacttattagtggtgacccattgaca
attaacctttcaggagaagaagtgacattgtcaaagtcagacaagtaa

DBGET integrated database retrieval system