KEGG   Leuconostoc garlicum: A9176_05740
Entry
A9176_05740       CDS       T04802                                 

Definition
(GenBank) beta-phosphoglucomutase
  KO
K01838  beta-phosphoglucomutase [EC:5.4.2.6]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_05740
Enzymes [BR:lgc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.6  beta-phosphoglucomutase
     A9176_05740
SSDB
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Other DBs
NCBI-ProteinID: AQN79878
LinkDB
Position
1130770..1131444
AA seq 224 aa
MTNFSEIKGFLFDLDGVIADTAKFHGQAWRQVADKVGTPWTDELAEGLKGISRMDSLQLI
LEASGQGDAYSDAEKAVLADEKNRNYQTLIATLTEADILPGMKAFITNAKAAGYQLAIAS
ASKNAPLILEHLGLIDDFVGIVDPATLAKGKPDPEIFVRSAEILSLPPEQTIGLEDSTSG
IEAINAAGAISLGIGDPNVLSAADLNFATTADVTLENIAALMDK
NT seq 675 nt   +upstreamnt  +downstreamnt
atgactaatttttcagaaataaagggcttcctctttgacctagatggtgtgatcgctgat
acggcgaagttccatggtcaagcttggcgacaggtcgctgacaaagttggcacaccttgg
acagatgaattggctgaaggcctcaaggggattagccggatggattctctccaactgatt
ttagaagccagtgggcagggcgatgcttatagtgacgcggaaaaagcagttttggctgac
gaaaagaaccgcaactatcaaacattgattgctacactgacagaagctgatattttaccg
gggatgaaggccttcattaccaatgctaaagcagcagggtatcaactcgccattgcttca
gcatctaagaatgcgccacttattcttgaacacctcggtttgatagatgattttgttggg
attgttgatccagcaacgcttgctaagggtaagccagatccagaaatctttgtgcggtcg
gctgaaattttatcattgccaccagaacaaacgattggcttagaagattcaacttctggt
attgaagcgattaacgccgctggcgcaatatcattgggtattggtgatccaaatgtgttg
tcagcagcagacttgaattttgcaacaactgcagatgtgacgcttgaaaacattgcggct
ttaatggataaataa

DBGET integrated database retrieval system