KEGG   Leuconostoc garlicum: A9176_05760
Entry
A9176_05760       CDS       T04802                                 

Definition
(GenBank) glucohydrolase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_05760
   00500 Starch and sucrose metabolism
    A9176_05760
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     A9176_05760
SSDB
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C hDGE_amylase iPGM_N
Other DBs
NCBI-ProteinID: AQN79881
LinkDB
Position
complement(1135887..1137533)
AA seq 548 aa
MMTKQTPPWWQSAIGYQIYPRSFQDTNHDGIGDLQGIIKRLPYLKWLGIDFIWLNPIYTS
PNVDNGYDIADFQNIAPEYGTLSDFKKLIAAAHKLDIRVIMDLVVNHTSNQHAWFKAAKT
SRTNPYHDFYIWQPNHHHQPPNNWTNFTGDSVWTYNQATDEWYFHLFAPEQPDLNWENPS
VQTEMINMITWWSEQNIDGFRLDALSHLKKVSFETPQPTGEHQFDIFANNPGIEKFLKRL
HDTFQSLHLMTVGEAGGVHADTARNWTGPQGFIDMIFELEHQSRQSEVPPRADINHLLSS
LTTWQTQLNSQGWLGLYLENHDQPRSLTVYGDNKPLAAKSLATLLLTLRGTPFIYQGEEL
GMTNIPFTSPDQIDDPPTYHDFQRFKSTGMTTDLALKKATSWSRDNARTPMQWTKFGFSD
NASDAKKTWLVTNPNTKTHNYQESRENPDAILNYYRRLIHLRRHDDNLKSGDFQLITMAN
TKILVFTRHTTDSQRLIIINLSDTAQTISLPKQLLKKDWQPLLATINPIPEISPTLNLQP
FQSIIWYH
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgatgacaaaacagacgccaccatggtggcaatcagcgattggctatcaaatatatcca
cgttcatttcaggataccaatcatgatggtattggcgatttgcaaggtattattaagcgc
ctaccctatcttaaatggcttggtattgattttatttggctcaatccaatttatacctca
ccaaatgtcgacaatggttatgacattgctgattttcaaaacattgcaccagaatatggg
acattatctgatttcaaaaagctgattgcagcagcgcacaaactagatattcgtgtcatt
atggatttagttgtcaaccatacatcaaatcaacatgcttggttcaaagcagctaaaacg
agtcgtactaacccttaccacgatttttatatttggcaaccaaaccatcatcaccagcca
ccaaacaattggactaattttactggcgatagtgtttggacctataatcaagcaactgat
gaatggtatttccacttgtttgcgccagaacagcctgatttaaattgggaaaatccatct
gtacaaaccgaaatgatcaatatgataacttggtggtctgaacaaaatattgatggtttt
cgtctggatgcgctcagtcatcttaaaaaagtttcatttgagacaccacaacccaccggt
gaacatcaatttgatatttttgctaataatccaggtatcgaaaaatttttaaaacggtta
catgacacttttcaatcactgcatttgatgactgttggcgaagctggcggtgtgcatgct
gacactgcgagaaattggacgggaccacagggtttcattgacatgatttttgaattagaa
catcaatcacgtcaatcagaagtcccaccacgcgccgacatcaatcatttattgtctagt
ttgacaacgtggcagacacaactcaattcccaaggctggctagggctatatcttgaaaat
catgatcagcctagatcactaactgtttatggcgataacaagcctttagcagcgaaaagt
ttggccactttgttactcacactgcgcggtacaccatttatttatcaaggtgaggaatta
ggcatgaccaacatcccctttacttcgccagatcaaattgatgatccaccaacttatcat
gattttcaacgctttaagtcgactgggatgacaacagatttagccttaaaaaaagcaaca
agttggtcacgtgacaatgctcgaaccccaatgcagtggaccaaatttggcttttccgac
aatgcatcagatgctaaaaaaacctggttggtcactaatcctaacacgaaaacgcataat
tatcaggagagtcgagaaaaccctgatgccatattgaattattatcgtcgcttaattcat
ctccgtcgacatgatgacaacttaaaatcaggtgattttcagttaatcactatggcaaat
actaaaattttagtgtttacacgacataccaccgatagccaacgcttaattatcatcaac
ttgtcagatacggctcaaacaatttccctacccaaacaactactcaagaaagactggcag
ccattgctagcaacgattaatcctataccagaaatatcaccaaccctgaacctgcaacca
tttcaatctattatctggtatcactaa

DBGET integrated database retrieval system