KEGG   Leuconostoc garlicum: A9176_05770
Entry
A9176_05770       CDS       T04802                                 

Definition
(GenBank) alpha-glycosidase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_05770
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     A9176_05770
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     A9176_05770
    3.2.1.135  neopullulanase
     A9176_05770
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_N hDGE_amylase GHL6
Other DBs
NCBI-ProteinID: AQN79883
LinkDB
Position
complement(1139191..1140975)
AA seq 594 aa
MNKAAIYHRPESEYAYLYTADELRLRIRTAKDDIQSISVVAGDPYNWQNGTWQKSANVVM
EKTLVTETHQYWQASLTAPFNRLNYGFILTDSFGDSVFYGDQGFETLTASANDDSGLMGA
NNYFKMPYFQEIDRFKAPDWVKKTVWYQIFPERFANGDTTNDPSGTLPWRSSDHPTAESF
YGGDLQGIINHLDHFSQLGINGLYLTPIFKAPTNHKYDTQDYFEIDPHFGTKEDFKLLVE
KAHAAGIRVMLDAVFNHIGDQSPQWQDVMANGRQSKYADWFHIHDFPVRYTPTDNFEYAA
DANYDTFAFTPHMPKLNTANPAVQNYLIDIATYWIKAFDIDGWRLDVANEVDHHFWKKFR
TAVTAIKPDIYILGEIWTSAQSWLQGDEFSAVMNYAFTGSIVDFFAKQQLSPSQMVHKLN
AQLMLNRDQTNQVMFNLLDSHDAPRILTVASNHQSIVKQMYTFMFLQQGTPDIYYGSEYA
MTGQQDPDNRRPMVWQSDEQDASMYAFLKHLIQLRHDYQTVLSEGTLSWETDDHKNIVSF
TRELGQTKIGAIFNAGHTNYAIPTTIDGAHIILEQLYNDQIIEPHGFIVTISNQ
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgaataaagcagcaatttatcatcgtcctgaatctgaatatgcttatttatatacagca
gatgaactacgattacgtatccgaaccgcaaaagatgatatccaatccattagcgtcgtt
gctggagatccctataattggcagaacggtacttggcaaaaatcggccaatgttgtcatg
gaaaaaacacttgtcactgagacccatcaatattggcaagcatcattaacagcgcctttt
aaccgtttaaattatggctttattttaactgacagtttcggcgattcagttttttatggt
gatcagggatttgaaacactcacagcttctgcaaatgatgacagcggtttgatgggtgcc
aataattattttaaaatgccctattttcaagaaattgatcgttttaaagcaccagattgg
gtcaagaaaacagtatggtaccaaatttttcctgaacgctttgccaatggggacacaacc
aatgatccatctggaacattaccttggcgctcaagtgatcatcccaccgctgaaagtttt
tacggcggggacttgcagggtattatcaaccatttagatcacttcagtcaactgggtatt
aacggcttgtatctcacacctatttttaaagcaccgactaatcataaatatgatacgcaa
gattattttgaaattgatccacattttgggacaaaagaagattttaaattattagttgaa
aaggcccacgctgccggaatcagagtgatgcttgatgccgtgttcaatcatattggtgat
caaagtccgcaatggcaagatgttatggctaatggtcggcaatcaaaatacgctgattgg
tttcatattcatgacttccctgttcgttatacgccgactgataatttcgagtatgctgcc
gacgcaaactacgatacattcgccttcacaccacacatgcccaaacttaacaccgctaat
ccagcagtacaaaattatctgattgacattgcgacctactggattaaagcatttgatatc
gatggctggcgtttggacgtggcgaatgaagttgaccatcatttctggaaaaaatttcgc
acggcagtaactgccatcaaacctgatatttatattctgggtgaaatttggacaagtgca
caatcatggttgcagggtgacgaattttcagccgtcatgaactatgctttcacaggatca
attgttgacttctttgccaagcaacaactttcaccatcccaaatggtccataaactcaat
gcccaactgatgctaaatcgcgaccaaacaaatcaggtcatgtttaatctacttgactcc
catgatgcgccacgtattctaaccgttgccagcaatcatcagtcaatcgtgaaacaaatg
tatacgtttatgttcttacaacaaggtacaccggatatctattacggtagcgaatatgcc
atgaccggccaacaagatcccgataatcggcgaccgatggtttggcaaagtgatgaacaa
gatgcatcaatgtatgcctttttaaagcacttgattcagctacgccatgattatcagact
gtcttgtctgaagggacactgtcttgggagacagatgatcacaaaaacattgtgagcttc
acgcgtgaactggggcaaacaaaaatcggcgccatatttaatgctgggcataccaattat
gccattccaacaacaattgatggcgctcacattattttagaacagctatacaacgatcaa
atcattgagcctcatggctttattgtgacgatttctaatcaataa

DBGET integrated database retrieval system