KEGG   Leuconostoc garlicum: A9176_06130
Entry
A9176_06130       CDS       T04802                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00230  Purine metabolism
lgc00620  Pyruvate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01230  Biosynthesis of amino acids
lgc01240  Biosynthesis of cofactors
Module
lgc_M00002  Glycolysis, core module involving three-carbon compounds
lgc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lgc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_06130
   00620 Pyruvate metabolism
    A9176_06130
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9176_06130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lgc04131]
    A9176_06130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgc04147]
    A9176_06130
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     A9176_06130
Membrane trafficking [BR:lgc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A9176_06130
Exosome [BR:lgc04147]
 Exosomal proteins
  Proteins found in most exosomes
   A9176_06130
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-ProteinID: AQN79952
LinkDB
Position
1206535..1207956
AA seq 473 aa
MKKTKIVSTLGPSSSDVETIVKLIQAGANVFRFNFSHGDHEEHLGRMNAVHEAEKITGKT
VGILLDTKGAEIRTTKQVDGKIEFQTGDVLRISMDENLEGTKEKIAVTYAGLFDDVQVGG
QVLFDDGLLGTTVLEKDVANRELVVRVDNDGILGSRKGVNAPGVSINLPGITEKDADDIR
FGLDHGINYIAASFVRKPEDVLEIRELLKEKNMEHVQIVPKIESQEGIDNLDAIIAVSDG
LMVPRGDMGVEIPAENVPLVQKEMIRKMNLAGLPVITATQMLDSMEENPRPTRAEASDVA
NAVFDGTDATMLSGESANGEYPVEAVATMAAIDEKAESSLPYYGRHQDLHFDETDSTEAV
ASAVSRIAHSVNAKAIVVSTNSGYTARMVSKYRPEVNILAVTYSERVQRGLTLNYGVLPV
VYEAPATIDEMIALAKTAVKEQGLANSGDTIVIAAGVPMSQSGTTNMITVQTV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaaaagacgaaaatcgtctcaacacttggtccgtcatcatctgatgtcgaaacaatc
gtcaagttgatccaagcgggtgccaacgtattccgcttcaacttctcacacggtgatcac
gaagaacacttgggccgcatgaatgctgttcatgaagctgaaaagatcacaggtaagaca
gtcggtatcttgttggacacaaagggtgctgaaatccgtacaacaaagcaagtcgatggt
aagattgaattccaaacaggcgacgttttgcgtatctcaatggacgaaaaccttgaaggt
acaaaggaaaaaattgccgtaacctacgcaggtttgtttgatgacgtgcaagtgggtgga
caagtcttatttgatgatggtttgcttggcacaactgttcttgaaaaggatgttgccaac
cgtgaacttgttgttcgtgttgacaatgatggtatcttgggatcacgtaagggtgttaac
gcacctggtgtttcaatcaacttgcctggtatcactgaaaaggatgctgatgacatccgc
tttggtttggaccacggtatcaactatattgccgcatcatttgttcgtaagcctgaagac
gtgctcgaaattcgtgagctgttgaaggaaaagaacatggaacacgtgcaaatcgtgcct
aagatcgaatcacaagaaggtatcgataaccttgatgctattattgctgtttctgatggt
ttgatggtgccacgtggtgacatgggtgttgaaattccagccgaaaacgtgcctttggta
caaaaggaaatgatccgcaagatgaacttggctggtttgccagttatcactgcgacacaa
atgcttgactcaatggaagaaaacccacgtccaacacgtgccgaagcttccgacgttgcc
aacgctgtcttcgatggtactgatgccacaatgttgtcaggtgaatcagctaacggtgaa
tacccagttgaagccgttgcaacaatggctgctatcgatgaaaaggctgaatcatcattg
ccttactacggtcgtcatcaagatcttcactttgatgaaactgattcaactgaagctgtt
gcttcagctgtatcacgtattgcccacagcgtaaacgctaaggcaatcgttgtgtcaaca
aactcaggttacacagcacgtatggtatcaaagtaccgtccagaagttaacattttggcc
gtgacttattcagaacgtgtacaacgtggtttgactttgaactacggtgtcttgccagtt
gtttacgaagcccctgcaacaatcgatgaaatgattgcattggctaagacagctgttaag
gaacaaggtttggctaactcaggtgacacaattgttatcgcagccggtgtaccaatgtca
caatctggtacaacaaacatgattactgtacaaacagtttaa

DBGET integrated database retrieval system