KEGG   Leuconostoc garlicum: A9176_06330Help
Entry
A9176_06330       CDS       T04802                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_06330
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A9176_06330
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A9176_06330
    1.1.1.-  
     A9176_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_N_assoc ADH_zinc_N_2 Glu_dehyd_C Pyr_redox_2 2-Hacid_dh_C PALP TrkA_N FtsJ AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AQN79987
LinkDB All DBs
Position
1254624..1255676
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGVKDVRVEDVTLKPLKANEVVVRVAYAGICGSDLHEYLEGPVFIPVEQPDGLT
GGQAPLTMGHEFSGVVEQVGADVTGFKVGDHVSVNPTVTKGEVADDVDVYDGYSFIGLST
DGGFTTHVNVPEANLYHLPQDFPLTLAATIEPTAVAVQAVKEGGLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSAVRLEKALEMGATDVVNPSEVDDTIAAIKAIIPDGADVT
FEVAGVQPTFEQAIAATRPRGTMVIVSIFAKPISFDPMQLMNAGVKLTTTIAYSKETFQK
TVDLVSQGLIDVAPVITDMIALDNIVTDGFESLTTDKSQAKILVNLADED
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggtgtaaaggatgtacgtgttgaggacgtgacgttaaaa
ccgttaaaggcaaatgaagttgtggttcgtgttgcctatgcgggtatttgtggcagtgat
ttacatgaatatctggaggggcctgtctttattccggttgaacaaccagatggtttgaca
ggtggtcaagcaccgctaactatgggacatgaattttctggggtggttgaacaggttggc
gctgatgtgactggctttaaagttggggatcatgtgtcagttaatccaactgtcactaag
ggtgaagtcgcagatgatgttgatgtgtatgatgggtatagttttattggtttgagtaca
gatgggggctttactacccatgtgaatgtcccagaagctaacttgtaccatttaccacag
gactttccgcttaccttagctgcgacgattgaaccaactgccgtagccgtacaagccgtt
aaagaaggtggcttgcgttttggtgaaaaagtggtcatctttggggctggaccaattggt
gtcttggttgccgcagcggctaaggcagcgggggcgactaaaattgtggctgttgattta
tcagcagttcgactcgaaaaagctttggaaatgggtgccactgatgtggtgaatcccagt
gaagttgacgatacaattgccgccattaaagccattattcctgatggtgccgacgtgacg
tttgaagtggctggcgtgcaaccaacctttgaacaagcgattgctgccacacgtccacgc
ggtaccatggtgattgtgtcaatctttgctaaaccaattagttttgacccgatgcaatta
atgaacgctggggttaagctgacgacaacgattgcttattcaaaagagactttccaaaaa
accgttgatttggtgagccaaggcctaatcgatgtggcgccagtgattactgatatgatt
gcgttggataacattgtcaccgatggctttgagtcattgacaaccgataagtcccaggca
aaaattttagtgaacttagcagacgaagactag

DBGET integrated database retrieval system