KEGG   Leuconostoc garlicum: A9176_06680
Entry
A9176_06680       CDS       T04802                                 

Definition
(GenBank) glucohydrolase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_06680
   00500 Starch and sucrose metabolism
    A9176_06680
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     A9176_06680
SSDB
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C DUF3459 Alpha-amylase_C Glyco_hydro_42C
Other DBs
NCBI-ProteinID: AQN80049
LinkDB
Position
1321747..1323429
AA seq 560 aa
MTAAIQWWQKAVVYQVYPRSFQDTDGDGIGDLKGITQRLDYIKKLGADVIWLNPVYASPD
KDNGYDISDYEAINTKFGTMADFDDLLAQAHDKGLKIMMDLVVNHTSDQHPWFIESRQSQ
DNDKRDFYIWRDPVDGHEPNNWGSFFSGPAWQFDDATGQYYLHLFVAGQPDLNWVNPEVR
QAVFDMMNFWVDKGIDGFRMDVISLISKPDGLPDGEVPEGGDYGNSNQAVANGPHVHEYL
QEMRQKVLNRADMVTIGEASGVDIENAVKYANQDHSELNMVFQFEHMDLDNNPNPALGKW
YDKKVSLVDLKANLSKWQNDLAGKAWNSLYWDNHDQPRAVSRYGDDRPEYRVVSAKMVAT
LLHFMQGTPYIYQGEEIGMTNAYNLQRDDFDDVEIKNAFKYLIDQDHLTDEATMLRYVHA
KGRDNAWTPMQWDDSTNAGFTTGTPWLKLNDNYETINVAVALDDPNSIFYYYQKLIRLRH
DLPIITTGVYQLLDPTDEQVYTYRRVGENDTLLVINNFTSDTLTRDYQVPETATLIIGNY
DDDTGTTLRPYEAKVYHLTN
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgacagcagcaattcaatggtggcaaaaagcagtggtttatcaagtttatccgaggtcc
tttcaggatactgacggtgatgggattggtgatttgaagggaattacacaacgccttgat
tacatcaagaaattaggcgccgatgttatttggcttaaccccgtttacgcatcgccagat
aaagataatggttacgacatttccgattatgaagccattaacacgaaatttggcacgatg
gctgactttgatgacctattagcacaagcccatgataaggggcttaagattatgatggac
ttggtggtaaatcacacctcagaccaacacccgtggttcattgaaagtcggcaatcacaa
gataatgacaagcgcgatttctatatttggcgcgatcccgttgatgggcatgagccaaat
aattggggatccttcttctcgggaccagcttggcaatttgatgacgctacgggacagtat
tatttgcatttattcgttgcagggcaacctgatttgaactgggtgaatcctgaagtacgt
caggctgtctttgatatgatgaatttctgggtggacaagggcattgatggttttcgcatg
gacgtgatttccctaatttctaagcctgatggcctacccgatggcgaagtacctgaaggt
ggggattatggtaattcaaatcaggcggtcgccaatggcccacatgtccatgaatatttg
caagagatgcgtcaaaaggtcttaaatcgggcagatatggtgaccattggcgaagcatca
ggggtggatattgaaaacgccgtgaagtatgctaatcaggatcattcagaattgaatatg
gtcttccaatttgaacatatggatcttgataacaatcccaacccagcgcttggcaagtgg
tatgataaaaaagtttcactggttgatttaaaagcgaatttatccaaatggcaaaacgat
ttggcgggtaaagcatggaattcattgtattgggataaccatgatcagccacgggctgtg
agccgctatggggatgaccgaccggaatatcgtgttgtttctgccaaaatggtcgcaacg
ctcctgcatttcatgcagggcacgccatacatttaccaaggtgaagaaattggtatgacg
aacgcctacaatttgcaacgtgatgactttgacgatgttgaaattaaaaatgcttttaag
tacttaatcgatcaggatcatttaaccgatgaagcaacgatgttaaggtacgtccacgcc
aaaggtcgggataatgcttggacacccatgcagtgggatgacagcaccaatgcgggcttt
accactggcacaccttggttgaagttgaacgataattacgaaacgattaacgtggcagta
gccttagacgatccaaattcaattttctattattatcagaagttaatccgcttacggcac
gacttgccaattatcactacgggtgtttaccaattattagatccaactgatgagcaagtt
tatacttatcgtcgagttggagaaaatgacaccttactggtcattaacaattttacaagt
gacaccttaacacgtgattatcaagtccctgagacggcaacgctaattattggtaattat
gacgatgatactggcacgacattacgtccctatgaagcaaaagtctatcacctgaccaac
taa

DBGET integrated database retrieval system