KEGG   Leuconostoc garlicum: A9176_07125
Entry
A9176_07125       CDS       T04802                                 

Definition
(GenBank) butanol dehydrogenase
  KO
K00100  butanol dehydrogenase [EC:1.1.1.-]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00650  Butanoate metabolism
lgc01100  Metabolic pathways
lgc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_07125
Enzymes [BR:lgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     A9176_07125
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-ProteinID: AQN80131
LinkDB
Position
complement(1419912..1421096)
AA seq 394 aa
MNNFNFQNKTAIRFGKNVIDTELHDAVAQFGQRVLLVFGGGSIKQSGLYDRVRAALTDLE
VVELSGIEPNPKIDSVRAGQDLVKTHDIDVVLAVGGGSVIDAAKVIASSKFYDADPWDLV
VESSKRYEIAQLPVVDILTLSATGTEMNLGSVISNPETNQKLGTGGPNSPAVSFLDPTLT
FSVSPWQTAAGAIDIFSHLTEQYFDQTPNDVTSGMMAGLYRAVIKNAPIALANPNDYDAR
AALMWASTMALNGLVDVGNTNGWTVHPIEHELSAYYDITHGVGLGIMTPRWMQRSLSAET
QPRFAQFGRDVWCLTGDDATVAQGAIQATFDWIKSLNVPTTLPGVGITDDTHFDAMANSA
VTVGHLDQAAYVTLQPQDVVALFQAAMTDDGFVK
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaataattttaacttccagaacaaaacggcgatccgttttgggaaaaatgtgattgac
accgaattacatgatgcagtggcccaatttggtcaacgtgtattacttgtatttggcggt
gggtcaattaagcaatctggtttgtatgaccgcgtacgggccgccttaacggatttggaa
gttgtcgaattatcaggcattgaacccaatccgaaaattgattctgttcgtgccgggcaa
gatttggtaaaaacacatgacattgatgtggttttggctgtcggcggtggttcggtgatt
gatgcggctaaagtcattgcatcatcaaagttttatgatgctgatccatgggatttggtc
gttgagtcatcaaagcgttatgaaattgcgcaattacctgtggtagatattttgactttg
tcagccaccggcacagaaatgaacttggggtcagttatttcaaatcccgaaaccaaccaa
aagctaggcactggtggtcctaactcaccagccgtatccttcttggatccaacgctgaca
ttttctgtgtcaccatggcaaacagccgcgggggcgattgatattttcagtcatttgacg
gaacaatattttgaccaaacaccaaacgatgtcacgtcagggatgatggcagggttatat
cgtgcagtaatcaaaaatgcgcccatcgcgttggctaatcctaatgattatgacgcgcgg
gcagctttaatgtgggcctcaacaatggcattgaatggcttagttgacgtgggtaacacg
aatggttggactgttcatcctattgaacacgaattatcggcttactatgacattacgcac
ggcgttggcttgggaattatgacaccacgttggatgcaacggagtttgtcagcagaaacg
caaccacgttttgcccaatttggtcgtgatgtctggtgcttgaccggtgatgatgcaaca
gttgcgcaaggtgccattcaagccacatttgattggattaagtcattgaatgtaccaaca
actttgccaggtgtcgggatcacggatgatacccattttgacgcgatggccaatagtgct
gtgacagttggccatcttgatcaagcggcttatgtaacgctacaaccgcaagatgtcgtg
gcgttattccaggcagcgatgacggatgacggctttgtcaagtaa

DBGET integrated database retrieval system