KEGG   Leuconostoc garlicum: A9176_07265
Entry
A9176_07265       CDS       T04802                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00280  Valine, leucine and isoleucine degradation
lgc00650  Butanoate metabolism
lgc00900  Terpenoid backbone biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9176_07265
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A9176_07265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9176_07265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9176_07265
Enzymes [BR:lgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     A9176_07265
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-ProteinID: AQN80157
LinkDB
Position
complement(1447352..1448512)
AA seq 386 aa
MTIGIDKIGFYTPNYVLDLTELAQARGDEPEKYTIGIGQSQQAVVPNYEDIVTMGVNAAQ
SILTDDDRAAIDMVIFATESGIDNSKSAAVYAQKLLNLSEFSRTIELKQACYAGTFGLMQ
ARDYVTLHPEKRVLVIAADIARYGLGTPGEVTQGAGAIAMVVASEPKILAINSDSVYMSR
NVADFWRPVDREEALVDGHLSTDVYKEMFLTLWQRYQKQTQHVLDDFAGFAFHLPYTKMG
KKALDQIMAEASPAQQTRLAEHLTASQVYSRQVGNLYTGSVYLSLLSLLSQATDLVAGED
IAVFSYGSGAEAELYSVTLQDNFADYVPNTMTDALLANRHQVSVAEYEAMFTSHLYDSHV
DAKTQARDDAKTVQFLGWQAGERLYR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacaatagggattgataaaatcggattttacacaccaaattatgtgttagatcttact
gaactcgcgcaagcacgtggagatgaaccagaaaaatatacgattggcatcggccaatcg
caacaagctgtcgtacccaactatgaagacatcgtgacgatgggcgttaatgctgcccaa
agtattttaacggatgacgaccgtgcagcgattgacatggtcatttttgccacggaatca
gggattgataattccaaatcagctgccgtctacgctcaaaaattgttaaatttatcagaa
ttttcgcgtactattgagttaaagcaggcttgctatgcggggacatttggtttaatgcag
gcgcgcgactacgtgaccttgcatccagaaaagcgggttttggtgattgcggccgatatt
gcccgttatggtttgggaacaccaggtgaagtcacacaaggggctggtgccattgccatg
gttgtggcgagtgaaccgaaaattttagcgattaattcagattctgtttatatgagtcgg
aatgtcgctgatttctggcgaccggttgatcgtgaagaagcgttagttgacgggcatctc
tcaactgatgtttataaagagatgtttttgacactttggcaacgttatcaaaagcaaacg
caacatgtccttgatgattttgctggctttgcgttccatttaccttatacaaaaatgggg
aagaaagcgctggatcaaattatggccgaagcgtcacctgcccagcaaacccgtttggct
gagcatttaactgctagtcaagtctatagtcgtcaggtgggaaatttatatactggatca
gtttatttgagtttgctatctcttttaagtcaggcaacggatttagtggctggggaagat
attgctgtctttagttatggttctggcgctgaagctgaattatattcagtgaccttacaa
gataactttgctgactatgtgccaaacactatgacggatgccttattggcaaaccgccat
caggtcagtgtggctgaatatgaggccatgttcacctcacacttgtatgattcgcatgtt
gacgcgaaaacccaagcccgcgatgatgccaaaacggtacaatttttaggttggcaagcc
ggcgaacggttgtatcgttag

DBGET integrated database retrieval system