KEGG   Leuconostoc garlicum: A9176_07790
Entry
A9176_07790       CDS       T04802                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00521  Streptomycin biosynthesis
lgc00562  Inositol phosphate metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    A9176_07790
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A9176_07790
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     A9176_07790
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-ProteinID: AQN80252
LinkDB
Position
complement(1544670..1545455)
AA seq 261 aa
MTLSQFEIQEIDQTVLLWLDDVRQQTLAAMTQELNVGTKNNPRDLVTNVDRANETFLNTK
IRAFDPEAHIVSEEGFGDQQLDMQGHVWFVDPIDGTMNFIKEKSDFAIMIGLYIDNQPVL
GWILDVMNNVVYHGGPEIGVYANQLRVSAPKNEPLSEGLVLLSGARLLYGMFGYDDIAKA
ALGFRIIGAAGPSFIRVILGQAVGYSSKMMPWDFAAGQVLAQTLGLSVSDIDGKPLDMLS
SNIVLVATNRAHRDILALHQS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacactgagccaatttgaaattcaagaaattgaccaaaccgtcctgttgtggcttgat
gatgtacgccaacaaaccttagcggcaatgacgcaggaattaaacgtcggcaccaaaaat
aatccgcgggatttggtgaccaatgttgaccgcgcaaacgaaacgtttttaaatactaaa
attcgcgcctttgatccggaagcccatattgtcagtgaagaaggctttggcgatcagcaa
ctggatatgcaagggcatgtgtggtttgtagatcccattgatggcacgatgaatttcatc
aaagaaaaatcggactttgcgattatgattggcctttatatcgataatcagcccgttttg
gggtggattcttgatgtgatgaataatgttgtttatcacggcggaccagaaataggcgtc
tatgccaaccaattacgcgttagcgcccctaaaaatgaacctttgtctgaagggttagtc
ttgttaagtggtgcgcgcttattgtatgggatgtttggctatgatgacattgccaaagcc
gctttaggttttcggattattggggctgcgggtccatcatttattcgcgttattttaggc
caggcggtcggttattcctctaaaatgatgccgtgggactttgcggctggccaagttttg
gcacaaacgctcggattgtcagtttcagatattgacggtaagcccctagatatgttatca
tctaacatagtattagtggctacaaatcgtgcgcatcgtgatattttagcgttgcatcaa
agctag

DBGET integrated database retrieval system