KEGG   Leuconostoc garlicum: A9176_07845
Entry
A9176_07845       CDS       T04802                                 

Definition
(GenBank) PTS sugar transporter subunit IIA
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc01100  Metabolic pathways
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_07845
   00500 Starch and sucrose metabolism
    A9176_07845
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_07845
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_07845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_07845
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     A9176_07845
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    A9176_07845
   N-Acetylglucosamine-specific II component
    A9176_07845
   Maltose/glucose-specific II component
    A9176_07845
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    A9176_07845
   Trehalose-specific II component
    A9176_07845
   N-Acetylmuramic acid-specific II component
    A9176_07845
   Alpha-glucoside-specific II component
    A9176_07845
SSDB
Motif
Pfam: PTS_EIIA_1 Peptidase_M23
Other DBs
NCBI-ProteinID: AQN80262
LinkDB
Position
complement(1554896..1555411)
AA seq 171 aa
MNWWQNLFISSSKHATVASTGQLNAVQIARKSELPVIVAPVTGQLQRITLDNDQLNNRHG
FMMIPNGRDIMSPVAGIVTDAVPQAITIRSERYGTVTVQVMCEKAQDVRLASYRAGQQLH
AGDLIGSVRQHDQSVRVYVLFEAQATPFVSYGAVYAGQNIWRSQEEIDAKE
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaactggtggcaaaatttatttatatcatccagcaagcacgcaacagtggcatcaacc
ggacaattaaatgctgttcagattgcgcgtaaatcggaattgcctgtcattgtggcacca
gtcacgggacaactgcaaagaattacgctcgataatgaccagttaaacaatcgtcatggt
tttatgatgattccaaacggccgtgatatcatgtcaccagtggcagggattgtcacagat
gcggtaccacaggcgatcacaattcgcagtgaacgttacgggactgttaccgtgcaagtg
atgtgtgaaaaggctcaggatgtcagattggcatcttatcgtgcggggcaacaattacac
gcaggcgatttgattggttcagttcgtcagcacgatcagtctgttcgcgtgtatgtctta
tttgaagcgcaggcgacgccatttgtcagctatggtgcagtttatgctggacaaaatatc
tggcggtcgcaagaggaaatcgatgcaaaagaataa

DBGET integrated database retrieval system