KEGG   Leuconostoc garlicum: A9176_07965
Entry
A9176_07965       CDS       T04802                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00030  Pentose phosphate pathway
lgc00051  Fructose and mannose metabolism
lgc00680  Methane metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
lgc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_07965
   00030 Pentose phosphate pathway
    A9176_07965
   00051 Fructose and mannose metabolism
    A9176_07965
  09102 Energy metabolism
   00680 Methane metabolism
    A9176_07965
Enzymes [BR:lgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     A9176_07965
SSDB
Motif
Pfam: F_bP_aldolase IMPDH
Other DBs
NCBI-ProteinID: AQN80284
LinkDB
Position
1580567..1581448
AA seq 293 aa
MTIVSGKAIVQTARDHGYAVGAFNTNNLEWTQAILRVAQAKQAPTIIAISMGAVNYMGGF
KTVAQLIRNLDDALNITVPIAIHLDHGDYEAAKASIQAGFTSVMFDGSHLPLAENLAKTR
EIVALAHAQDISVEAEVGSIGGEEDGIIGTGEIAPIADAIAMIETQIDFIAAGIGNIHGR
YPANWQGLNLPHLQKLTTTLDAITNHQVPFVLHGGSGIPDDQIKTAIRLGVAKVNVNTEA
QLAFHQALREFILTDQDLIGKNYDPRKLLAPGVTAIEASLADRLAVFGAPFKN
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacaattgtttctggtaaagctattgtacaaacagcccgtgatcacggctacgccgtg
ggtgcttttaataccaataatcttgaatggacacaagcaatcctccgagtcgcacaagca
aaacaagccccgacgatcattgctatctcaatgggcgctgttaactatatgggtgggttt
aaaaccgttgcacaattgattcgcaaccttgatgacgccctaaatattacggtacccatt
gccattcaccttgaccatggtgactacgaggcggccaaagcctctattcaagctggtttt
acgtcggttatgtttgatggctcgcatttaccattagcggaaaacttagccaaaacgcgt
gaaatcgtcgcgttagcccatgcgcaagatatttcagtggaagctgaagttggcagtatc
ggaggcgaagaggatggcatcattggcactggtgaaattgccccaattgctgatgccatt
gccatgattgagactcaaattgactttatcgctgcaggtattggcaatattcacggccgt
taccccgctaattggcaaggactaaatctgccccatctccaaaaattaacaaccacacta
gacgccatcaccaaccatcaagtgccgtttgttttacatggtggatcgggtatcccagat
gatcaaatcaaaacagccattcgcctaggtgttgccaaagttaatgtgaatactgaagca
caattagcctttcatcaagcattacgcgaatttattttaaccgaccaagatttaattggt
aaaaactatgatccaagaaaattattggcaccaggtgtcactgccattgaagcaagttta
gctgatcgcttagctgttttcggcgccccttttaaaaactaa

DBGET integrated database retrieval system