KEGG   Leuconostoc garlicum: A9176_07980
Entry
A9176_07980       CDS       T04802                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_07980
   00500 Starch and sucrose metabolism
    A9176_07980
Enzymes [BR:lgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A9176_07980
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_43 Glyco_hydro_32C Urease_beta
Other DBs
NCBI-ProteinID: AQN80287
LinkDB
Position
complement(1582930..1584201)
AA seq 423 aa
MLVTNDTIAFEKYHLYPTKGLLNDPNGLVFFKGQYHVFYQWNPKACDHKYKEWGHFISDD
LKTWRRVESALKPSLENLDSAGIYSGAAFVKDDRLYVFYTGNVRDAAGHSVKSSQMWAVS
DDGIHFEKLGELFPHPAGFTKDVRDPMVWQGDNGHYFLILGAQHDNQVGDIIIYESVDFK
NWTFKGSLLGDQLRDVRGYMLECPGLITVDGKQILMFSPQGLAPDHVHHRYENIHNTGYV
IGTFDETTARFQVETDFEEVDQGFEFYAPQTMNAPDGRRIMWGWAGMMTPEREAAVPTIA
TADWVHVLTVPRALHVTADNHLVQQPIQEILAPTVLDIQSLDHLTVGQYRVQTDADWSVA
LGDHATLKRVGQTLYFERQQWEDHRLDTRQMTGNLDELLLIVDNDVIEVYTEDGLQVMTG
RYF
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgttagttacaaatgatacgattgcttttgagaaatatcacttatatccaaccaaaggg
ttacttaatgatcccaacggcctcgtattttttaaaggccagtaccacgttttttaccag
tggaatccaaaggcttgcgaccataagtataaagagtggggccattttatttcagatgat
ttgaagacatggcgtcgggttgaatccgctttaaagccgtcactggaaaatttggattcg
gccggtatctactcgggcgccgcttttgtcaaagatgatcgactctacgtcttctatact
ggtaacgtgcgcgatgcggctggtcacagtgtgaaatcatcgcaaatgtgggcggtgagt
gatgatgggattcattttgaaaaactcggtgaattatttcctcatccggcagggtttacc
aaagatgtgcgagatccaatggtttggcagggtgataatggacattatttcttgatttta
ggggcgcaacacgataatcaagttggcgatattatcatttatgaatcggttgattttaag
aactggacatttaaaggctcattgctaggtgatcaattacgcgatgttcgtggttatatg
ctggaatgtccaggattgatcactgtcgatggcaagcaaattttgatgttttctccacaa
gggttagcaccagatcatgtgcatcatcgatatgagaacattcataacacggggtatgtg
attggcacttttgatgaaacaacggcacgttttcaggtcgaaacagactttgaagaagtt
gatcaagggtttgaattctatgccccacaaacgatgaacgcacctgacgggcgacgcatc
atgtggggatgggctggcatgatgacacccgaacgggaagcagctgtgccaacaattgcc
acagccgattgggtacatgtgttaacggtaccacgggcattacacgtcacagccgacaat
cacttagtgcaacagccaatccaagaaatattggcgccgacagtacttgacattcagtcg
cttgatcatctgacggttggtcaatatcgtgtacagactgatgcggattggtcggtggcc
ctgggtgatcatgccacattaaagcgagtgggccaaacgttgtattttgaacggcaacag
tgggaagatcatcgtttagatacgcgtcaaatgacgggcaaccttgatgaactcttgctg
attgtagacaatgatgtgattgaagtttatactgaagatggtttgcaggttatgacggga
cgttatttctag

DBGET integrated database retrieval system