KEGG   Leuconostoc garlicum: A9176_07985
Entry
A9176_07985       CDS       T04802                                 

Definition
(GenBank) PTS beta-glucoside transporter subunit EIIBCA
  KO
K02810  sucrose PTS system EIIBCA or EIIBC component [EC:2.7.1.211]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_07985
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_07985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_07985
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     A9176_07985
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component
    A9176_07985
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIA_1 PTS_EIIB HisKA_4TM Lpp-LpqN Peptidase_M23 Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: AQN80288
LinkDB
Position
complement(1584211..1586175)
AA seq 654 aa
MKYDEVAKRVANAVEQDNIIAAAHCATRLRLVVKDVKKIDQDALDNDPDLKGTFNANGQY
QIIVGPGDVNGVYDEFVKLTGVKQASTDDLKQIAAQSGKKNPIMDLIKVLSDIFVPLIPA
LVAGGLLMALNNILTGAGMFGPKSLVQMFPQITGLAEMVNLMASAPFAFLPILIGITATR
RFGGSEILGAAAGMMLVMPSLVNGYNVAEAVATGKMPTWDLFGLHVAQAGYQGQVLPIIG
VAFILATLEKFFHKHLKGAIDFTFTPMLAMLITGFVTFIVVGPILRVISNGITDGLTWMV
TTFGFIGYGIFGSFYSAIVITGLHQSFPAIETQLLANIAKTGGDFIFPIAASANVAQGAA
TFAIYFLAKGNPKMRALASSAGASAMLGITEPALFGVNLKYKFPFFIALGASGVASLMMG
LFHVMSSSLGPAGLIGFIAIPANKWVGFFISVIIAFVLAFVVTFVYGRSHMPASDTPKAP
VVPDETVVAVGLSVNAPVAGALVDIATVNDPVFSSGMMGQGVAIEPSDNQIVAPADGLIT
VAYATKHAYGLKTDDGVEVLIHVGIDTVNLEGKGFTSEVVQGQYVTKGTVLGTFDKQVIA
DAGYPVTTMVVVTNSQSYEKVVHDKPFGSKVVPTDVVLTAVPEAAAENLIVAPV
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaagtatgatgaagtagcaaagcgcgtggcaaacgcggtcgaacaagacaacattatt
gctgcagcgcactgtgccacacggttacgacttgtcgtcaaggacgtcaagaaaattgat
caagacgctttagacaatgatccggatttgaaagggacctttaacgcaaatggtcagtat
caaatcattgttggacctggcgatgtgaatggtgtttatgatgaatttgtgaagctaacc
ggcgttaaacaagcctcaacagatgacttgaagcagattgccgcacagtctggtaagaaa
aatccaattatggatttgattaaagttttgtctgatatctttgtgccactgattccagcc
ttggttgctggtggtctactaatggccttgaataatatcttgaccggtgctggcatgttt
ggaccaaagtcattggttcagatgttcccacaaattactggcttagctgaaatggttaac
ctaatggcgtcggcaccatttgccttcttacccattttgattgggattacagcgacacgg
cggtttggtgggagtgaaatcctgggtgctgcggctggtatgatgttggtgatgccaagc
ctggtcaacggttataacgtggctgaagcggtggcaactggtaagatgccaacttgggat
ttgtttggtttgcatgttgcccaagctggttatcaaggtcaagtgttaccaattatcggg
gttgcctttattcttgccactttggaaaagttcttccataagcatttgaaaggggcgatt
gactttacctttacgccaatgcttgcgatgttgattacaggatttgtgaccttcattgtg
gtcggaccaatcttgcgcgtcatctcaaacggtatcaccgatgggttgacttggatggtg
acaacctttggctttattggttatggtatctttggatcattctattcagccattgtgatt
actggcttgcatcaaagtttcccagcgattgaaacacaattgttagccaatatcgccaaa
actggtggtgactttatcttcccaattgctgcttcagctaacgtggcgcaaggggccgca
acctttgcgatctatttcttggccaagggaaatccaaagatgcgtgccttggcatcatca
gccggcgcctcagcgatgcttggtatcactgaacctgccttgtttggggtcaaccttaag
tacaaattcccattctttatcgccttaggggcttctggtgttgctagcttgatgatgggc
ttgttccatgtgatgtcctcatcacttggcccagctggtttgattggtttcattgcaatc
ccagcaaataagtgggttggcttctttatctcagtgattattgcctttgtgctcgcgttt
gtggtaacgtttgtttacggccgctcacacatgcctgcttcagatacaccaaaggcacca
gttgtgcctgatgaaacagtcgttgctgttggcttgtctgtaaatgcgccagttgctggt
gcattagtggatattgccacggtaaatgatccagttttctcaagtggtatgatgggacaa
ggtgttgcgattgaaccaagtgataatcaaatcgtagcgccagccgatggcctgatcacc
gttgcttatgcgacaaaacacgcttatggattaaaaacagatgacggtgttgaagtatta
attcacgtcggaattgatacggttaacttggaaggtaagggctttacgtcagaagttgtt
caaggccagtatgtcacgaaggggacagtgcttggtacatttgataagcaagtcattgct
gatgccggctatccggtcacaacgatggttgtggtgaccaacagtcaatcatatgagaaa
gtagtccatgacaagccgtttgggtcaaaggttgtcccaactgatgttgttctgactgct
gtacccgaagcagcggctgaaaatctgattgttgcaccagtttaa

DBGET integrated database retrieval system