KEGG   Leuconostoc garlicum: A9176_08070
Entry
A9176_08070       CDS       T04802                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00052  Galactose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00541  O-Antigen nucleotide sugar biosynthesis
lgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A9176_08070
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_08070
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A9176_08070
Enzymes [BR:lgc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     A9176_08070
SSDB
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase FAD_oxidored FAD_binding_2 DAO HI0933_like FAD_binding_3 Pyr_redox_2 Pyr_redox_3 Thi4 Pyr_redox
Other DBs
NCBI-ProteinID: AQN80304
LinkDB
Position
complement(1601205..1602395)
AA seq 396 aa
MTNKFNTKNYDYLVVGAGPFGMIFAYEAAKRGKRSLIVEKRPYIGGNMHTHTEHGITVHD
FGAHIFHTDNKEVWDYIRQFAEFNGYQNQVVANYKGTLYNLPFNMNTFYQMWGTKTPAEA
QAKIAEQKAAALADLGDRQPRNLEEQAISLIGTDIYEKLIKGYTEKQWGRKATELPAFII
KRLPVRFIYDNNYFNHRYQGIPVGGYTQIFERMVAQSNGLIDVLTDTDFFDHKDTLLAEF
PRVLYTGMIDQFFDYKFGELEYRSLRFEHEVVDSENYQGNAVINYTDAETPYTRVMEWKH
FDGLADEGKTIITREYPQEWNREKEAYYPVNDDKNTQIYKQYAKEARTKHAEIIFGGRLG
KYRYFDMDQVINDALNTVREEFGVAPDFNFAHDNVK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacaaataaatttaatacgaagaattatgactacttagttgttggtgctggaccgttc
ggcatgatttttgcctacgaagctgccaagcgtggcaagcggtctctgattgttgaaaag
cgcccttatattggcggtaacatgcatacccatactgaacatgggattacggtgcatgat
tttggcgcacacattttccatacagataataaagaagtgtgggactatattcgtcaattc
gccgaatttaatggctatcaaaaccaagtggtggcgaactacaaaggcacattgtacaat
ttgcccttcaacatgaatacgttctatcaaatgtggggaaccaagacacctgccgaagca
caagccaaaattgctgaacaaaaggctgcggctttggctgacttaggcgatcgccaacca
cgtaacttggaagaacaagcgatttcattaatcggaactgacatttacgaaaagctcatt
aagggttacacggaaaagcaatgggggcgtaaggccactgaattgccagcctttattatt
aagcgcttgccagtacgctttatttacgataacaactactttaaccaccgctatcaaggg
attccggtgggtggttatacgcaaatttttgagcgtatggtggcccaatcgaacggcttg
attgatgtcttaacagacactgacttctttgatcataaggacacgttattagccgaattc
ccacgggtactctacacgggcatgattgatcaattctttgactataagtttggggaatta
gaatatcgttcactccgttttgagcatgaagtagtggattcagaaaactatcaaggtaat
gctgtcattaactatacagatgccgaaacaccttacacgcgtgtcatggaatggaagcac
tttgatggtttggctgacgaaggtaaaacaatcattacgcgcgagtatccacaagagtgg
aaccgtgaaaaagaagcgtattacccagtcaacgatgacaaaaacacgcaaatctacaag
caatatgcgaaagaagcacggacaaagcacgcagaaattatttttggtggtcgcttaggg
aagtatcgttactttgacatggatcaagtgattaatgatgctttgaacacggttcgtgaa
gaatttggggtcgctccagatttcaacttcgcgcatgacaacgttaaataa

DBGET integrated database retrieval system