KEGG   Leuconostoc garlicum: A9176_08090
Entry
A9176_08090       CDS       T04802                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00052  Galactose metabolism
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00521  Streptomycin biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Module
lgc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
lgc_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_08090
   00052 Galactose metabolism
    A9176_08090
   00500 Starch and sucrose metabolism
    A9176_08090
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_08090
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A9176_08090
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A9176_08090
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A9176_08090
SSDB
Motif
Pfam: ROK BcrAD_BadFG
Other DBs
NCBI-ProteinID: AQN80425
LinkDB
Position
complement(1604939..1605898)
AA seq 319 aa
MAKDKLIGVDLGGTTIKFAILTDAGEIQQKWSIKTNIFDEGSHIVPDIIASINHHLDLYQ
LDRERVIGIGMGTPGTVNRETGTVTGAFNLNWKTEQPVKADIEAGTGLPLTLDNDANAAA
LGEAWKGAGNNDKDVSFVTLGTGVGGGLVANGQLIHGTAGAGGEVGHVVVEPNGYLCTCG
NRGCLEQYASATGVVHLAQDFSEAYVGSSKLKQLISDGDEVTSKIVFDLAKDGDFLANEV
VDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARVEKNWQTFAFPTVRTSTRVK
LAELGNDAGVIGAASLARA
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctaaagataagctcatcggtgttgaccttggtgggacaacaattaaatttgcaatc
ttgactgatgcaggtgaaattcaacagaagtggtcaattaagacaaacatttttgatgaa
gggtcacacattgtaccagacattattgcgtcaattaatcaccatcttgacttgtaccaa
ttggatcgcgaacgtgtgattggtattgggatgggaacacctggtacggttaaccgtgaa
acaggaacagtcactggtgccttcaacttgaactggaagacagaacaacccgttaaggct
gatatcgaagctggtactggtttgcctttgacgcttgacaacgatgccaacgctgctgca
cttggtgaagcctggaagggtgccggtaacaatgataaggatgtgtcattcgtgacactt
ggtactggtgttggtggtggtttggttgccaatgggcaattgattcacggtacagccggt
gctggtggtgaagttggtcacgtggttgttgaaccaaatggttacttgtgcacatgcggt
aaccgcggttgcttggaacaatatgcctcagcaacaggtgttgtacacttggcacaagat
ttttcagaagcttacgttggttcatcaaagttgaagcaattgatttctgacggtgacgaa
gtgacatcaaagattgtctttgacttggcaaaagatggtgacttcttggcaaatgaagtg
gtggataaggtggcttactaccttggttatgccacagcggcaatgtcaaacattttgaac
ccatcagccgttgttatcggtggtggtgtggctgcagctggtgaattcttgcgcgcacgt
gtcgaaaagaactggcaaacatttgctttcccaactgttcggacatcaacgcgtgttaag
ttggccgaattgggtaatgatgccggtgttattggtgccgcttcattagcacgtgcctaa

DBGET integrated database retrieval system