KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_102400Help
Entry
LOTGIDRAFT_102400 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00052  Galactose metabolism
lgi00500  Starch and sucrose metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LOTGIDRAFT_102400
   00500 Starch and sucrose metabolism
    LOTGIDRAFT_102400
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LOTGIDRAFT_102400
    3.2.1.20  alpha-glucosidase
     LOTGIDRAFT_102400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 20229606
NCBI-ProteinID: XP_009043722
JGI: 102400
UniProt: V4BGX7
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
RFDTGVGGLVFADQFLQISTKLPSTSIYGFGENLHHSFRHDLSFETWSMFSRDQPTKHLN
HYGVHPFYVGMEDDGKAHGVLLLNSNAQDYSFTPLPMLTYRTIGGILDFYIFMGPTPENV
IQQYTKAIGRPMMPPYWSLGFQLCRYGYDSLDNLKAAVDRTKAGDIPHDVQYADIDHYDN
NKIFTVDQEKFGGLSEYFSQLRAEGMSTIIILDPCIVSNETNYQPYDDIRQISGSIMWPD
NFNIPDGSADTDKAMFGYVWPQGKVVFPDYFKTETSKLWKKWIKDYHKKLVFDGLWIRPW
NWPEKDKPYWSLKCGNNTWDDPPYRTTRLSDKTLCLVGRQGDRGQYSHYDVHSLYGWSQT
MPTFDGLQEATGERGIVVTRSTFVGSGQHSGHWLGDNKSTWEDLRLSIIGMLEFNLFGIP
YVGADICGYFEDTNVELCKRWMQLGAFYPYSRNHNGKGYIDQDPGALGEEVVIASREALR
TRYQLLPYLYTLFHQAHVDGNTVVRPLHHEFPDDKKTYGIQEQFMWGRSLLISPILYPNQ
TKLKMYKPNGVWYDFYSKTAVSGPTTGLYKTLDISSDSKIPLHIRAGSILCLQDHARNTR
ESRKRPMRLLVALDVNNNITNGELFWDDGVSIDTYENGNYYKAEFEFKEV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
agattcgatacgggagtaggtggcttggtcttcgccgaccaatttttacaaatctccacc
aaactaccttctactagtatttatggttttggagaaaatcttcatcattccttccgccat
gatctgagttttgaaacctggtcaatgttttcaagagaccaaccaacaaaacatcttaat
cactacggtgtccacccattttatgttggaatggaagacgatggtaaagctcacggtgtt
ttattgttgaacagcaatgcccaagattattcgtttacaccccttccaatgcttacatac
agaacgataggtgggattttagatttctatattttcatgggaccaacaccagagaatgtc
atacagcaatacactaaagctattggtcgtcctatgatgccaccttattggtctctggga
tttcaactgtgtcgctatggttatgacagtctagataatttgaaagctgccgttgacaga
acaaaagctggtgacataccacacgatgtacaatatgctgatatagatcattatgataac
aataaaatattcactgttgatcaagaaaaatttggcgggttatcggaatatttcagtcag
ttacgtgcagagggcatgagtaccataatcattttggacccatgtatcgtatcgaacgaa
acaaattatcaaccctatgatgatattcgtcagattagtggatctattatgtggcctgat
aacttcaacattccagatggtagcgctgatacagataaagctatgtttggctatgtttgg
cctcaaggaaaagttgtttttcctgattattttaaaacagaaaccagcaagctgtggaag
aaatggatcaaagattaccataagaagctcgtctttgatggactttggattagaccatgg
aactggcctgaaaaggacaaaccatactggagcttaaaatgtggcaataatacatgggac
gatcccccatatagaacaactcgactatcggataagacattgtgtcttgttggtcgacag
ggtgatcgagggcaatacagtcactatgatgtccattctttatatgggtggagccaaacc
atgccgacatttgatggattacaagaagctacgggagaaaggggtatcgtagtgaccaga
tcaacatttgtaggaagtggtcaacattctggacattggctaggagataataaaagtaca
tgggaagatctcagactttcaattattggaatgctggagtttaatttgtttggaattcca
tatgttggtgctgatatctgtggatattttgaagatacaaatgtggaactgtgtaaaaga
tggatgcagttgggagccttctatccctacagtagaaatcataatggcaaaggatatatt
gatcaagatcctggagcattaggcgaagaagtagtcatagcatcaagggaagctttaagg
actcgttatcaactattaccctatctgtatacattgtttcatcaagctcatgttgacggt
aatacagtagtccgccctcttcatcacgaatttccagacgataagaaaacttatggtatc
caagaacagtttatgtggggacgatctcttttgatatcaccaattctttatcctaaccaa
actaaactgaagatgtataaaccaaatggtgtgtggtatgatttttattctaaaacagct
gtatctggaccaactactggcctatataaaacattagatataagttccgattcaaaaata
ccactacatatccgggctggttcaatcctgtgtttgcaggatcatgccagaaatactagg
gaaagtcggaaaaggccaatgagactattggtagctttggatgttaacaataatataact
aatggggaattattttgggatgacggagtttcaattgatacttatgaaaatggaaattat
tacaaggcagaatttgaatttaaagaggtatag

DBGET integrated database retrieval system