KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_110541Help
Entry
LOTGIDRAFT_110541 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
Organism
lgi  Lottia gigantea (owl limpet)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 20230597
NCBI-ProteinID: XP_009045443
JGI: 110541
UniProt: V4B9C0
LinkDB All DBs
Position
Unknown
AA seq 299 aa AA seqDB search
NQINDLHNNQINDLNNNQTDDLHNNQSDDLYNIKIDGLHNYQTDDLHNNQIDDQHNNQSD
DLYNNQINDLHNNQTDDLHNNQIDDQHYNQTDDLHNNQNNDLYNNQINDLYNDQMDDLHN
KQTDDLHNNQINDLYNDQMDDLHNKQIDDLHNNQFDGLHNNQINDLYNDQTNDLHSNQIN
DLYNNQMDDPQINKTDDLHSNQIDDLHNNQINDLHNEQTGDLHNNQTDDLYNNQIDDLHN
NQIDDLYNNQIDDLHNNQTDDLYNNQIDDLHNNQTDDLYNNQIDDLQLSIKTYVDNPFC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
aatcagattaatgacctacataataatcagattaatgatctaaataataatcagactgat
gacctacataataatcagagtgatgacctatataatattaagattgatggccttcacaat
tatcagactgatgacctacacaataatcagattgatgaccaacataataatcagagtgat
gacttatataataatcagattaatgacctacacaataatcagactgatgacctacacaat
aatcagattgatgaccaacattataatcagactgatgacctacataataatcagaataat
gacctatataataatcagattaatgacctatataatgatcagatggatgacctacataat
aaacagactgatgacctacataataatcagattaatgacctatataatgatcagatggat
gacctacataataaacagattgatgacctacataataatcagtttgatggcttacataat
aatcagattaatgacctatataatgatcagactaatgacctacatagcaatcagattaat
gacctatataataatcagatggatgacccacaaatcaataagactgatgacctacatagt
aatcagattgatgacctacataataatcagattaatgacctacataatgaacaaactggt
gacctacataataatcagactgatgacctatataataatcagattgatgacctacataat
aatcagattgatgacctatataataatcagattgatgacctacataataatcagactgat
gacctatataataatcagattgatgacctacataataatcagactgatgacctatataat
aatcagattgatgacctacaattgagcataaaaacttacgttgacaatccgttttgttag

DBGET integrated database retrieval system