KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_118685Help
Entry
LOTGIDRAFT_118685 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lgi01002]
    LOTGIDRAFT_118685
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_118685
   04090 CD molecules [BR:lgi04090]
    LOTGIDRAFT_118685
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LOTGIDRAFT_118685
Peptidases [BR:lgi01002]
 Metallo Peptidases
  Family M2
   LOTGIDRAFT_118685
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_118685
CD molecules [BR:lgi04090]
 Proteins
  LOTGIDRAFT_118685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF5499
Motif
Other DBs
NCBI-GeneID: 20231644
NCBI-ProteinID: XP_009055044
JGI: 118685
UniProt: V4ABK2
LinkDB All DBs
Position
Unknown
AA seq 1116 aa AA seqDB search
QMESLVSEMEGIYSVGKVNMSDGKALELAPGLTKVLAESRNYDKLLEAWKGWRDSSGKLM
KTKYEEFVHLSNEGVQELGYKDTGDYWRSWYESKTFQQDVESLLHQLHPLYKQLHGYVRK
QLKTVYGDDKFPYSGHIPAHLLGNMWAQHWNNIYDLVEPYKNKTTLSVTNEMKRQEYTVE
KMFWTAEDFFKSLGLEEMPMPFWKHSMIRKPDGRDVVCHASAWDFYNKKDFRIKMCTDIT
MEDLITIHHEMGHIQYYLQYKDQPVIFRRGGNPGFHEAIGDTMALSASTPNHLRSIGLLK
TIPNDPESDINFLMSQALQKIAFLPFGYLIDQWRWSVFSGETVKDNYNRKWWDLRCKYQG
ISPPVKRTEEDFDPGAKYHIPANTPYIRYFVSYVIQFQFHKGLCQAANHTGSLRSCDIYG
SKAAGEKLAKMLKLGSSKPWPEAMKMVTGSTKMDASALMEYFQPLIDWLKKENEGEDLGW
DENCPEDGLIQADRWLKSYDKRAEKATNAMYEGDWAYQTNITDYTSKMSVKRRVELDLFK
KKAAMEANQLDWKNFKNTEIKRQFKKITNIGPSAMKSNTALEKMQQLQSKMEGVYGAATV
CLEENRCYPLEPDLTRMMAKDRDSKKLKSIWELWRDKTGRLMKTDYSEFVKLSNMGYFFY
ATGYKDTGEYWRSAFESETFIQDLRGLLKQLHPLYEQLHTYVRMKLKSIYPDEDFPTSGH
IPAHLLGNMWAQQWNNIYDILQPYKNRSSVDVTPTMKKQNYTVKKIFRTAEYFFLSLGLK
KMPDSFWTDSLMEKPKDGRNVVCHASAWDFYNAKDFRIKMCTDINMEDLVTVHHEMGHIQ
YFLQYSHFPQAFRDGANPGFHEAVGDTLALSVSTPGHLRKIGLLKPGADNQLDVINFLMK
MALEKIAFLPFGYLIDQWRWSVFSGETTPDNYNQKWWNLRCKHQGIFPPVKRTEDDFDPG
AKYHIPDNTPYIRYFVSFVIQFQFHKALCQAANHTGPLYKCDIYQSKAAGKLLGDMLSLG
ASKPWPEAMEKITGQRKMDAQPLLDYFQPLMKWLQKQNLDERPGWSTSCPDSNDFVKETK
KGNTGPVSTGNQVQFSSYVVVLVFSIVLSLTHFNFV
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
cagatggaaagtcttgtatcggaaatggaaggtatttatagtgttggaaaggtcaacatg
tctgatggtaaagctctagaattggctccaggattgacgaaggtgcttgccgagtcgagg
aattacgataagttactcgaggcatggaaagggtggagagattcgtccggtaaactgatg
aagaccaaatatgaagagtttgtacacttgagtaatgaaggtgtacaggaattgggatat
aaagacacaggggattattggagatcatggtatgaaagtaaaacatttcaacaagatgtg
gagagcctgctacatcagcttcatccactatacaaacaattacatggttatgtcagaaaa
caactgaagacagtttatggtgatgataaatttccttatagtggccacatcccagcacat
ttattgggaaacatgtgggcccaacactggaacaatatctacgatcttgttgaaccatat
aaaaataaaacaactctgagtgtaacgaatgaaatgaagcgtcaggagtatacggtggag
aagatgttctggactgccgaggattttttcaagtctttaggattggaggagatgccgatg
ccattctggaaacattctatgatcagaaaacctgacggcagagacgtcgtctgtcatgct
tcagcttgggatttttataataaaaaagatttccgaatcaagatgtgtacagatataaca
atggaggatctgataaccatccatcacgagatgggacacatccagtattaccttcaatat
aaagatcaaccagttattttcaggaggggtggaaacccaggttttcatgaagctatcggt
gatacaatggctctgtcagcttctaccccaaaccacctaagatctattggtctcctgaaa
actatacctaatgacccagagagcgacatcaacttcctaatgagccaagctctacagaag
atcgccttccttccatttgggtatctgatagaccaatggaggtggagtgtttttagtgga
gaaacagtcaaagacaattataatagaaaatggtgggatctcagatgtaaatatcaagga
atatcaccaccagtaaaaagaacagaagaagattttgatcctggagctaaatatcatatt
cctgccaacactccgtatatcagatattttgtaagttatgtgattcagttccaatttcat
aaaggtctgtgtcaggcagccaatcataccggatctctaaggtcatgtgatatttatggt
tctaaggcagccggtgaaaaactagcaaaaatgttgaaacttggatcttcaaaaccctgg
ccagaagctatgaaaatggtaaccggaagtacaaagatggatgccagtgcgttgatggaa
tattttcagcctctgatagattggttgaagaaggagaatgaaggcgaggatctgggctgg
gatgaaaactgtcctgaagatggtctgattcaagctgacaggtggttgaagtcatatgat
aagcgagcagaaaaagctactaatgctatgtatgaaggtgattgggcttatcagacaaat
attactgattatacttccaagatgtcggttaaaagaagagtagaattagatttatttaag
aaaaaggcggcaatggaagccaaccaattagactggaaaaactttaaaaacacagaaatt
aaaagacagtttaaaaagataactaatataggacctagtgccatgaaaagtaacacagct
ttagaaaagatgcaacaacttcagtctaaaatggaaggagtttatggtgccgccacagtt
tgtttggaagaaaatcggtgttatcctctagagccagatctgacgcggatgatggctaaa
gaccgagactctaagaaattaaaatctatctgggaactatggagagataagactggtaga
ttgatgaagacagactatagtgaatttgtgaaactgtccaatatgggttattttttttac
gccacaggttataaagatacgggtgaatattggagatcagcttttgaatcggaaaccttt
atacaagatctccggggtttgctgaaacagttacacccattgtatgaacagcttcatacc
tatgttcgtatgaaattaaaaagtatttatcctgatgaagattttcctacttccggccat
attcctgcacacttattaggtaacatgtgggcccaacaatggaacaatatttacgatatt
ctacaaccttataaaaatagaagcagtgttgatgtcaccccaaccatgaaaaaacagaat
tatactgtaaagaaaatcttcagaacagcagagtatttctttctgagcttaggtttgaaa
aaaatgccggatagcttctggacagattcgttgatggaaaaaccaaaagatggtcgcaat
gtagtctgccatgcttcagcttgggacttctacaatgccaaggactttagaatcaagatg
tgtacggatattaatatggaagatttggtcacagtccatcatgaaatgggacatatacaa
tattttctacagtacagtcattttccccaagcatttagagatggggccaatccaggtttc
catgaagcagtcggagatactctagccctatctgtatctaccccggggcatctcagaaaa
ataggattactgaaaccaggggcagataatcaactggatgttattaattttttgatgaaa
atggcattagagaagatcgcctttctaccatttgggtatctgatagaccaatggaggtgg
agtgtttttagtggagaaactacaccagataactacaaccagaaatggtggaatctgaga
tgtaaacaccagggtattttccctccggtaaaaagaacagaagatgatttcgacccagga
gctaaatatcatatacccgacaacaccccatatataagatattttgtgagcttcgtgatc
cagtttcagttccataaagctctatgtcaggccgccaaccatactggacctctgtataaa
tgtgatatttatcaatccaaagcagcggggaaattattaggagatatgttgagtttaggt
gcctctaagccctggccagaagcgatggagaaaataacaggacagaggaaaatggacgca
caaccattactggattatttccaacctctgatgaaatggttacaaaaacagaaccttgac
gaacgaccaggttggagtactagttgtcctgattccaacgattttgttaaagaaacgaag
aaaggaaatacgggaccagtatccactggaaatcaggttcaattttcatcctatgttgtg
gtattagttttttcgattgtgttatctttaacgcattttaattttgtgtaa

DBGET integrated database retrieval system