KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_120790Help
Entry
LOTGIDRAFT_120790 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00330  Arginine and proline metabolism
lgi00340  Histidine metabolism
lgi00380  Tryptophan metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LOTGIDRAFT_120790
   00340 Histidine metabolism
    LOTGIDRAFT_120790
   00380 Tryptophan metabolism
    LOTGIDRAFT_120790
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     LOTGIDRAFT_120790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid DUF1965 Cu_amine_oxidN2 Cu_amine_oxidN3 PRiA4_ORF3 Spc7_C2
Motif
Other DBs
NCBI-GeneID: 20231898
NCBI-ProteinID: XP_009056941
JGI: 120790
UniProt: V3ZM09
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MKKLSVITLILALSVVANVGLIAFVIWLATHKDETIPTICGDEEPNPKLFKDATYQNIFE
DLNSSEINEVLDYLYSQSELKLVKPDKANLTTNYIIGLELHVPNKSQALKFLDGNGREIP
PAREAKAYLFLPQNDPPVVEEYIVAPIPRPTRYYHNPRRIKDIPYRVRQFSNTEMVVAVN
LLRKEVATKVENMLKRSYGASFICKKNCLTFTASAVSSAFSKERKLWITSLYQLEFATLH
PVGFQILINMDGINASNWKIEKLWYANKMFSSVEELVRKYENNEIPKALIRPPKASPGET
SVPGSLNIRGKRFPDVPTSGPKQYEPQGHRYRVRNQHVDYLQWEFNFRMSYASGIQLYDI
KFQNERIMYELSMQEIIVIYAGATPHGLYAQLSDSAFGIGNRAHGMMPGVDCPEHATFVD
SVIYNEDNLTPKTYPNAICVFEHNTALPLRRHRSGSSRSGFFNSGLVDYVLILRTMFVMF
NYDYIIDFVFHQNGAIDVKVHSTGFILSSLYYHEEGAYGFRVSESSIAPVHHHLFSFKAD
MDILGTKNRYMTLDTEVENRTRKWYENGEYHTQLTFKRNLKSTEQKAAYKYNFNTPKYHL
IINNDKLNKYSEPRGYRILGKGFSKQILPENHGFERTITWSRYQMCVTKRKDSEDTSSSM
YSMFDSGDPVVDFVSYINDNENIVDEDLVAWLSLGMHHIPHTEDVPNTATTGNEMSISFL
PFNYFTEDPSMGSRDAVRVDSKIKSKGQKADVTIERYGTPHKFSCLAKQYDFQKIVNNAS
VLFQQP
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattgtctgtgatcacgctaattctggctttgtcggtcgttgcaaacgttgga
ctgattgcattcgttatctggttagccacgcataaagatgaaacaattccgacaatttgt
ggcgatgaagaacctaatcctaagctttttaaagacgctacttaccaaaatatctttgaa
gatttgaattcatcggaaattaacgaagtattggattacttatattcccaatcagaatta
aagttggtcaaaccagataaagctaacttgacaacgaattatatcataggactagaacta
catgttccgaacaaatcgcaagcacttaaatttctcgatggaaatggtcgtgagataccc
ccagctcgagaggcgaaggcatacctgtttctgccacagaatgacccacccgttgttgaa
gagtatatcgttgctcccataccacgaccaacaagatactatcataatccaagaagaatc
aaagatatcccatatagagttcgacaattcagcaacacagagatggtcgtagcggtcaac
ttacttcgaaaagaagttgctaccaaggtcgaaaatatgttgaagcgaagttacggcgct
tcgtttatctgcaagaagaactgtctcacgtttacagcatcggccgtctcttcagcgttt
tcgaaggagagaaagttgtggattacgtctttgtatcaactagaattcgcaacacttcat
ccagttggttttcaaattcttattaatatggacggcatcaatgcctcaaattggaaaatt
gaaaaactttggtatgcaaataaaatgttttcatcggtagaagaattagtccggaaatac
gaaaataacgaaatcccaaaagcattgatcagaccaccaaaagcatccccaggagaaaca
tctgttccgggctcactgaatatacggggtaaaagattccctgatgtaccaacatcaggt
cctaaacaatatgaaccccaaggacatcgctatagagttagaaatcaacatgtggattat
cttcaatgggaattcaattttaggatgtcatatgcatcagggattcagttgtacgacata
aagtttcaaaatgagaggattatgtatgagttgagtatgcaggaaataattgtgatttat
gctggagcaaccccacatggtctttatgctcagttatcggacagtgcttttggtattggt
aatcgcgctcatggtatgatgccgggtgtcgattgtccggaacatgccacttttgtggat
tctgttatctacaacgaagacaatcttacgcctaaaacgtatcctaacgcaatttgtgta
tttgaacataacacggcgttacctttacgtcgtcatcgctctggaagttcccgaagtgga
ttctttaattcgggattagtagattatgttcttattctccgaactatgtttgtaatgttt
aattatgactacatcattgattttgtatttcatcaaaacggtgctattgacgttaaagtg
cattcgactgggttcattctgtccagtttgtattatcatgaagaaggagcttatgggttt
cgtgtttcggaatcgtctattgcccctgttcatcatcatttattcagttttaaggcagat
atggatatactcggaaccaaaaatcgatacatgactttggatacagaggtagaaaatcga
accaggaaatggtatgaaaatggtgaataccatactcaactgacttttaaacgcaattta
aaatctactgaacaaaaggcagcatataaatacaattttaataccccgaaatatcattta
atcataaacaatgacaaactaaacaaatactcagaacccagaggatatcgaattcttggg
aaaggattcagtaagcaaattttaccagaaaaccacggtttcgaacgaactataacgtgg
tcgagatatcaaatgtgtgtaacgaaacggaaagatagtgaagatactagcagttcaatg
tattcaatgtttgatagtggtgatcctgtagtcgattttgtttcctatataaatgataat
gagaatattgtagatgaggatttagttgcttggcttagtcttggcatgcatcatatacct
catacagaagacgtacccaatactgccaccaccggaaatgagatgtcaatatctttctta
ccttttaactattttactgaagatccgtcgatgggatcacgcgatgctgttcgagttgat
tcgaaaatcaagtcaaagggtcaaaaggcagacgtgactattgaacgctatggaactcct
cataaattttcttgcttagccaaacaatatgattttcaaaagattgttaataatgcttcg
gttctatttcaacaaccttga

DBGET integrated database retrieval system