KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_159357Help
Entry
LOTGIDRAFT_159357 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00071  Fatty acid degradation
lgi00410  beta-Alanine metabolism
lgi00592  alpha-Linolenic acid metabolism
lgi00640  Propanoate metabolism
lgi01040  Biosynthesis of unsaturated fatty acids
lgi01100  Metabolic pathways
lgi01200  Carbon metabolism
lgi01212  Fatty acid metabolism
lgi04146  Peroxisome
Module
lgi_M00087  beta-Oxidation
lgi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LOTGIDRAFT_159357
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOTGIDRAFT_159357
   00592 alpha-Linolenic acid metabolism
    LOTGIDRAFT_159357
   01040 Biosynthesis of unsaturated fatty acids
    LOTGIDRAFT_159357
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LOTGIDRAFT_159357
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LOTGIDRAFT_159357
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     LOTGIDRAFT_159357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 20238035
NCBI-ProteinID: XP_009051932
JGI: 159357
UniProt: V4ARA4
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MTENKTVDTTNEENGIYKILKDFPPGPLDIYRSKATFCWKKMMLFLEGEDILKFKNMFWK
TLENDALFARQDETSLEKIRDIATQRVKRLYEYNFLPDEELFFNPLKHNIYTQLIGMVDW
SMSTKSMLNFEMFGGSVQNMGSARHAQLIEDNKAFQNFGCFALTELSHGSNTKAMRTKAT
YDPQTKEFVLTTPDFEATKIWVGNLGKSATHAVVYAQLYTPDGWCHGLHAFSVPVRDPMT
LKPYPGIFVGDMGEKIGLNGIDNGFLAFNSYRLSRECLLDKFGDVSEEGKYITPYKDPSK
RFGASLGALSGGRVGITGMAVVNIKLAITIAIRYSAVRRQFGPAEEEIPVLEYQLQQWRL
IPYLAAVYAVDNFSNSFFMDFVMLRVGMMAGDNSKRQSELGREIHALSCSAKPIASWIAR
DGIQECREACGGHGYFKVNRLGDIRNDNDPNCTYEGDNNVILQQTSNYILGMAETFKNTK
GKFETPLGSLSFLSDIHSILKSKFKASSPTDCCQPQVALAAYKWLVCYLTMESAERVKQE
SLSGKDSFTARNDSQAFYCRTLSLAYIECNILERFVKLLEEKDNEATPVELKPVLTRLCA
LYGLWSMEKHLTTFYQGGYVSGSEPPKLIRESILKLCRELKNDAVSLVDAIAPPDYILSS
PIGLSDGQIYKNLYGAMLQTPDCLQRPHSWQDFLDKPIAGSRPKAKL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaataaaacagttgacaccaccaatgaagagaatggcatttacaagattctg
aaagattttccacctgggcctttagatatctacaggtctaaagctacgttttgctggaaa
aagatgatgttatttttggaaggagaagatatactgaaatttaagaatatgttttggaag
acattagaaaatgatgcactgtttgcaagacaagatgagaccagtttagagaaaattcga
gatatagccactcagagagttaaaagattatatgaatataattttctccctgatgaagaa
ttgtttttcaatcctttaaaacataatatatatacacaacttattggtatggtagactgg
agtatgtcaactaaaagtatgctcaattttgagatgtttggaggcagtgtacagaatatg
ggttcagctagacatgctcaacttatagaagataataaggcatttcaaaattttggatgt
tttgctctgacagaattgagtcatggtagtaataccaaagcaatgaggacaaaggccacg
tatgatcctcaaacgaaggaatttgtattgacaactccagattttgaagctactaaaata
tgggttggtaatctaggaaaatctgctacccatgctgtagtttatgctcaactctatact
ccagatggttggtgccatggtctgcatgccttcagtgttcccgtccgtgatcctatgact
ttaaaaccttatcctggtatatttgtgggtgatatgggtgaaaagattggattgaatgga
attgataatgggtttctagcttttaatagttatagactatcaagagaatgtctattagat
aaatttggtgatgtttcagaagagggcaaatatataactccttataaggatcctagtaag
agatttggtgcatcattaggagctctatcaggaggtcgtgttggtataactggtatggct
gtagtcaatattaaactagctattactatagctatcaggtactcagctgtcaggagacaa
tttggtccagcagaagaagaaataccagtgttggaatatcaattacaacaatggagatta
ataccatacctagctgctgtgtatgctgtagataatttctctaattcattcttcatggat
tttgtaatgttacgtgttggtatgatggcaggggataacagtaaaagacagagtgaatta
ggccgagagatacatgccttatcttgttctgctaaacctatagctagttggatagccaga
gatggaatacaagaatgtcgtgaagcttgtggtggtcatggctacttcaaagttaatcgt
ttgggtgatatcagaaatgacaatgatcctaactgtacttatgaaggagataataatgta
attttacaacaaactagtaactatatactgggtatggcagaaacatttaaaaatactaaa
ggaaaatttgaaacaccattaggtagtttatcatttctatcagatatacattctatatta
aaatcaaagtttaaagcttctagtccaactgactgttgtcaacctcaagtggcattagca
gcgtataaatggttagtatgttatctgacaatggaatcagctgaaagagttaaacaggaa
tcattatcaggaaaagattcattcacagctcgtaatgatagtcaagctttttactgtcgt
actctatcattagcttatatagagtgtaatatattagagagatttgtaaagttactagaa
gaaaaagataatgaagctacaccagtagaattaaaaccagtattaactagactctgtgcc
ttatatggtctatggagcatggaaaaacatcttacaactttttaccaaggaggttatgtg
tctggaagtgaaccacccaagttaatacgagagtctatattaaagttatgtcgtgaatta
aagaatgatgctgtatcactagtagatgctatagcacctcctgattatattttatcttca
cctattggcttatctgatggccagatttataagaatttatatggtgctatgttacagact
cctgattgtttacaaagaccacattcctggcaagatttcttagataaacccattgctggt
tctagacctaaagccaaattataa

DBGET integrated database retrieval system