KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_161404Help
Entry
LOTGIDRAFT_161404 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lgi01002]
    LOTGIDRAFT_161404
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_161404
   04090 CD Molecules [BR:lgi04090]
    LOTGIDRAFT_161404
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LOTGIDRAFT_161404
Peptidases [BR:lgi01002]
 Metallo Peptidases
  Family M2
   LOTGIDRAFT_161404
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_161404
CD molecules [BR:lgi04090]
 Proteins
  LOTGIDRAFT_161404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 20238687
NCBI-ProteinID: XP_009055045
JGI: 161404
UniProt: V3ZRZ0
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MTAFKLGLLLLVMNFVHSELITNETAAREFANEVNAGSEVVMYNFVAASWNYNTNITTEN
QQAMVDESLKLALFDQAVEANASRYDWKNFSDTDLNRLFSKLVDIGTAAMTDKVKLERLN
NIMSEMEAIYSTGKVCLTENNCLPLDPDLSRLMATSTDYDELLTVWKGWRDATGAKIKDL
YKEFVSLSNEAIVQNGYPDTGAYWKSWYDTPTFEEDLKTLFETLKPLYVNLHAYTRKKLK
ERYGADKFPTSGHIPAHILGNMWAQTWGNLFDLLEPYPGKDDIDVTPQMVQQNYTAEKMF
QVSDEFFKSLGLIEMPSEFWDHSMLKKPTDGRDVVCHASAWDFYNKKDFRVKQCTDITME
DLITVHHEMGHIEYYLQYKDQHVVYRDGANPGFHEAVGDVISLSVQTPTHLQKIGLLPEV
TNDEEAEINFLMKMALQKIAFLPFGYLIDQWRWSVFSGETTPDNYNQKWWDLRCGLQGIS
PPEDRTEDDFDPGAKFHIPGNTPYIRYFVSFVIQFQFHKSLCQAAGQNVPLHQCDIYQST
AAGQKLSEMLKLGSSKPWPEAMMMIAGEDKMNAAALMEYFQPLTTWLIEQNDVYKLVFAE
SNP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgtttaaactcggtctgcttctccttgtaatgaattttgtacacagcgagtta
ataactaatgaaactgcagcacgtgagtttgccaatgaagtaaatgccggttcagaagtg
gtgatgtataattttgtggctgcatcatggaattataacacaaatattaccacagaaaac
caacaggcaatggtagacgagagtctgaaactggcgctgtttgatcaggcggtggaagct
aatgcttctcgatatgactggaaaaattttagtgataccgatttaaacagactgttttct
aaattagtggacattggaacagctgccatgacagacaaggtcaaactagagaggctaaac
aacatcatgtcagaaatggaagctatatatagcactggaaaggtctgtttgaccgagaat
aattgtcttcccttagatccagatctttcacgactgatggcgacctccactgactatgat
gaactgttaacggtttggaaaggatggcgagatgcgactggtgccaagattaaagattta
tataaagaatttgtcagtttgagtaacgaagctatagttcagaacggatatcccgatact
ggtgcctattggaaatcctggtatgacacacccacatttgaagaagatctgaaaacccta
tttgaaaccctgaaacctctctatgtaaatttacatgcctatacaagaaagaagttgaag
gaacgatatggtgctgataaatttcccaccagtggacacatacctgctcatatattgggt
aatatgtgggcacagacgtggggtaatttgtttgatttgttggaaccataccctggtaaa
gatgatatcgatgtaacaccacaaatggttcaacagaactatacagcagaaaaaatgttt
caagtttctgacgagttttttaaatctcttggactgattgagatgccgtcggagttctgg
gaccactccatgctgaaaaaacctacagatggaagagacgtcgtgtgtcatgcatcagcc
tgggatttctacaacaaaaaagactttcgagtaaaacaatgtacagatataacaatggaa
gatttaataactgttcatcatgagatgggccatatagaatattatttacaatataaagat
caacatgttgtttatagagacggagctaatccaggtttccatgaagctgtaggagatgtt
atctcactatctgtacaaacgccaactcatctgcagaaaataggtttactaccggaagtt
actaatgatgaagaggctgagattaattttttaatgaagatggcactacagaagattgcc
ttcctaccatttgggtatctgatagaccaatggaggtggagtgtttttagtggagaaact
acaccagataactacaaccagaaatggtgggatctcagatgtggtctacaaggtatatcc
ccaccagaagatagaacagaagatgattttgaccctggggcaaaatttcacatccctggc
aacacgccttacattagatattttgtgagttttgtgattcagttccagttccacaaatct
ctctgtcaggcggcaggacagaatgtacctctacaccagtgtgatatctatcagagcaca
gcagctggacaaaaattgagcgaaatgttaaaactgggctcatccaaaccctggcctgaa
gccatgatgatgatagccggtgaagacaagatgaatgcagctgccctgatggaatatttt
caacccctgaccacatggttaatagaacaaaatgatgtttataaacttgtgtttgcagaa
tctaatccctaa

DBGET integrated database retrieval system