KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_177987Help
Entry
LOTGIDRAFT_177987 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00010  Glycolysis / Gluconeogenesis
lgi00053  Ascorbate and aldarate metabolism
lgi00071  Fatty acid degradation
lgi00280  Valine, leucine and isoleucine degradation
lgi00310  Lysine degradation
lgi00330  Arginine and proline metabolism
lgi00340  Histidine metabolism
lgi00380  Tryptophan metabolism
lgi00410  beta-Alanine metabolism
lgi00561  Glycerolipid metabolism
lgi00620  Pyruvate metabolism
lgi01100  Metabolic pathways
Module
lgi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOTGIDRAFT_177987
   00053 Ascorbate and aldarate metabolism
    LOTGIDRAFT_177987
   00620 Pyruvate metabolism
    LOTGIDRAFT_177987
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOTGIDRAFT_177987
   00561 Glycerolipid metabolism
    LOTGIDRAFT_177987
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOTGIDRAFT_177987
   00310 Lysine degradation
    LOTGIDRAFT_177987
   00330 Arginine and proline metabolism
    LOTGIDRAFT_177987
   00340 Histidine metabolism
    LOTGIDRAFT_177987
   00380 Tryptophan metabolism
    LOTGIDRAFT_177987
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LOTGIDRAFT_177987
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LOTGIDRAFT_177987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 20244249
NCBI-ProteinID: XP_009048780
JGI: 177987
UniProt: V4AZT8
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MSGTPAPITSPEVKYAKIFINNEFVNAESGKTFQTINPSTGEVICEVAEGDAADVNKAVK
AANQAFRLGSPWRRLDASERGNLLYRLADLIERDRGYLASLETLDNGKPYNVALAADLGL
VVKCYRYYAGWANKNHGKTIPIDGDFFAYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALA
MGNTVVMKTAEQTPLTALHVAHLAIEAGFPPGVINVISGYGPTAGAAIARHNDVDKVAFT
GSTEVGQIVAKSAADSNLKRVTLELGGKSPNIVMADADLDYAIEQSHFGLFFNQGQCCCA
GSRVYVEEKIYDEFVEKSTERAKKRTVGDPFTNVEQGPQVDKEQFDKVMKYINIGQKEGA
KMTTGGKRVGDKGYFIEPTIFKDVGENMKIQQEEIFGPVMSIAKFKNLDEVIEKSHNTIY
GLAASVFTKDLDKALYLSNSLRAGTVWVNCYDVLDASVPFGGYRMSGNGRELGEYGLDNY
TEVKTVTIKIPQKNS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcaccccggcccccatcacatcaccagaagtaaagtatgccaagattttcatc
aacaatgaatttgtgaatgcagaaagcgggaaaacatttcaaacgataaatccatcaaca
ggggaggtaatttgtgaagtcgctgaaggagatgcagccgatgtaaataaagctgtgaaa
gcagccaatcaagcttttagattagggtcgccatggagacgattggatgcctcagaacgc
ggaaatcttctatacagattagcagatttgatagagcgagacagaggctatttagcatct
ctagaaacactggataatggcaaaccctataatgtggctttagcagcagatttaggactg
gttgtcaagtgctacagatactatgccggttgggccaacaaaaaccatggaaaaacaatt
ccgatagatggtgatttttttgcatacacccgtcatgaaccagttggtgtttgtggacag
attattccatggaattttccattattgatgcaagcttggaagttgggacctgctctggcc
atgggaaacactgttgtcatgaaaactgccgaacagacgcctcttactgccttacatgtt
gctcatttagccattgaggctggcttcccacctggtgtaattaatgttatctcaggatac
ggaccaactgctggagctgccatcgctagacataatgatgtagataaagtggctttcact
ggatccacagaggttggtcagattgtagcaaaatcagcagcagactcgaatttaaaaaga
gtgaccttagaattaggaggaaagagtcccaatattgtcatggcagacgcagaccttgac
tatgccatagaacagtcccattttggattatttttcaaccaaggccaatgttgttgtgca
ggaagtagagtttacgtagaagagaagatatatgatgagtttgttgaaaaaagcaccgaa
agagccaagaaacgaactgttggagatccttttactaatgttgaacaaggacctcaggtt
gataaagaacagtttgataaagtgatgaagtatatcaatataggacagaaggaaggagcc
aagatgacaactggaggaaaacgtgtgggtgataagggatattttattgaaccaaccata
tttaaagatgtaggagaaaacatgaagattcaacaagaagagatttttggaccagttatg
agtattgccaaatttaaaaaccttgatgaagtcattgaaaagtcccacaacacaatttat
ggtttggctgcttctgtctttaccaaagatttagacaaagctttgtacctgtccaacagt
ctacgtgctggcacagtttgggtgaactgttatgatgtgttagatgccagtgttccattc
ggtggatacagaatgtctggaaatggaagagaacttggtgaatacggtttagataactat
actgaagtgaaaacagtcacaatcaaaataccacagaagaattcttag

DBGET integrated database retrieval system