KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_181794Help
Entry
LOTGIDRAFT_181794 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00480  Glutathione metabolism
lgi00980  Metabolism of xenobiotics by cytochrome P450
lgi00982  Drug metabolism - cytochrome P450
lgi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LOTGIDRAFT_181794
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    LOTGIDRAFT_181794
   00982 Drug metabolism - cytochrome P450
    LOTGIDRAFT_181794
   00983 Drug metabolism - other enzymes
    LOTGIDRAFT_181794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgi02000]
    LOTGIDRAFT_181794
Enzymes [BR:lgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LOTGIDRAFT_181794
Transporters [BR:lgi02000]
 Other Transporters
  Pores ion channels [TC:1]
   LOTGIDRAFT_181794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin GST_N_4 GST_C
Motif
Other DBs
NCBI-GeneID: 20244458
NCBI-ProteinID: XP_009051643
JGI: 181794
UniProt: V4AKX6
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MSTKEVKLYSSWFCPFAQRAWIALLEKKVNFQYMEIDPYNKTKEFLSINPRGLVPVIVNN
GKCVYESSICIEYVDEAWRNQDTDLMPSDPYERARLRIWSDFISRKIIPAFYQYLMRQSL
LNHLETLTSEMSDSGPFFQSSLFGLVDIMLVPFTIRFDMLKHFRGFELPETQIFQRLRRW
MEAAHSRETVKATMADGKKLIDKYQRYADDSVKSEVADAIRKGTALP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgaaggaagtcaaattgtacagttcatggttctgtccttttgctcagcgtgca
tggatagctttgttggaaaagaaggtgaactttcagtacatggaaattgatccatacaat
aaaaccaaggaatttctctctatcaatcctcgaggattagtccccgtgattgtgaacaat
ggcaagtgtgtctatgaatcatccatctgtatagagtatgttgacgaagcttggaggaac
caagacactgatttaatgccttcagatccgtatgaaagagctcgtttgcgcatttggtca
gatttcattagtcgtaaaattatacctgcgttttaccaatatctgatgcgtcaatctctc
ctgaatcatctagagaccctaacctctgagatgtctgacagcggtcccttctttcaaagc
tctctgtttggcttggtcgacataatgctggtgcctttcacgatccgttttgatatgctg
aaacattttcggggttttgaactgccagaaacgcaaattttccagagactaagaaggtgg
atggaagcagcacattcaagagaaactgtaaaagccacaatggccgatggaaagaaattg
attgacaaataccagcgatatgctgacgattctgtcaaatctgaagtagctgatgcaata
agaaaaggaacagcccttccgtag

DBGET integrated database retrieval system