KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_191561Help
Entry
LOTGIDRAFT_191561 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00480  Glutathione metabolism
lgi00980  Metabolism of xenobiotics by cytochrome P450
lgi00982  Drug metabolism - cytochrome P450
lgi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LOTGIDRAFT_191561
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    LOTGIDRAFT_191561
   00982 Drug metabolism - cytochrome P450
    LOTGIDRAFT_191561
   00983 Drug metabolism - other enzymes
    LOTGIDRAFT_191561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgi02000]
    LOTGIDRAFT_191561
Enzymes [BR:lgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LOTGIDRAFT_191561
Transporters [BR:lgi02000]
 Other Transporters
  Pores ion channels [TC:1]
   LOTGIDRAFT_191561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 20244938
NCBI-ProteinID: XP_009058339
JGI: 191561
UniProt: V4A7R5
LinkDB All DBs
Position
Unknown
AA seq 233 aa AA seqDB search
MAMTQKSFATGSTYPPLADGVLRVYSMRFCPFAQRTRLVLQHKKIPHETVNVDLKKKPEW
FLERNPFGLVPTLEQGDKIVYESNICNVYLDEAYPGEKLISTDPYQKARDQILIDTFGKV
TAAHFKLLRNIDGPDEFVKELKRYEEALKQRGNYFGGNKPNMVDFTVWPWFERFQLLEMV
DFKLDAANFPLILAYINRMYELPAVKATMFDKESHLTFVKSYQAGEPNYDFGL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacacagaaatcttttgcaacaggttcgacttacccaccgctggcagatgga
gtcctcagagtatacagtatgagattctgtccttttgcccagagaacacgactggtgcta
caacacaaaaaaatcccacatgaaacagtcaatgtagatttaaaaaagaaaccagaatgg
ttcttggagaggaatccttttggtctggtaccaactttagaacaaggagataagattgta
tatgaaagtaatatctgtaatgtttatctagatgaagcttaccctggtgaaaaactcatt
tcaactgatccttatcaaaaagctcgtgaccagatccttattgatacctttggaaaggta
acagcagcccattttaaactcctgaggaatattgatggtccagatgaatttgttaaagag
ttaaagagatatgaagaagccttgaaacagagaggaaattactttggaggtaataaacca
aatatggtagattttactgtatggccgtggtttgagagatttcaactgttagagatggtg
gattttaaacttgacgctgccaactttcctttgatattagcctatatcaacagaatgtat
gaactaccagcagttaaagctaccatgtttgataaagaatcacatttgacttttgtcaaa
tcttatcaagcaggggaacctaactatgactttggcttatga

DBGET integrated database retrieval system