KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_192045Help
Entry
LOTGIDRAFT_192045 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    LOTGIDRAFT_192045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lgi03036]
    LOTGIDRAFT_192045
Enzymes [BR:lgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LOTGIDRAFT_192045
Chromosome and associated proteins [BR:lgi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     LOTGIDRAFT_192045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 20244961
NCBI-ProteinID: XP_009058992
JGI: 192045
UniProt: V4A5N9
LinkDB All DBs
Position
Unknown
AA seq 1063 aa AA seqDB search
MGDMLWGKVGGHPWWPCMVSECPYTFQFTKLSGSRMTRMYHVQYFGNEGERGWITESSTI
PFKGLKEFLDHADEQIQTASKKLKPKVVQSFKIQPTRKCAWDIGVAQATEAFNFDIKERQ
EKYTFVYDLKQNFTTVKSKDTPGTPPKKRGRKRKVESDETSPSSVDEPNTPVEQNSKRQK
LDSREEDKSDDSLVKALFTRPKTVKYEASFDTFYNKHEESVLDEHPDWSGDEVREHLSQQ
WSIMTDKQKARYKTKFTVDSDTPSSPADEDKKGQQNVNPKSTGTRKVEEPEKQQKQKKSE
KKDTPKPPKESTKPPKSKSRRSESVSSTATPEDATEDTESSVPEGKEKKKSRKSKNLLSV
PANHDSDSGSEKSEPRVILQSTIKSGDGEYELDIFKLHATSNAKRENICVICEQPGQLLE
CQGACQGHFHASCLKVSDYQEAEFKCNECETGNHTCFGCKEASPETRKCSVSSCGKFYHE
SCFKKYPQSRIEGKSYFCPLHTCATCAADNPKNPKATKGRLLRCVRCPVAYHAGDYCIAA
GAINLAGNHIVCSKHFQPNKTQRHHAHVNVSWCFQCSKGGTLLCCESCPAAYHPECLKLS
FPEGSWYCQDCSSGKKPLYGDLIWIKIGNYRWWPGEICHPRNVPLNIQEKTHQVGEFPVR
FFGSHDFYWTHQGRVFLFQEGDKGSRDQSEAKGLAKIFGKEATEAFKIWQAAKANKEQLE
KENNSKKPAPFKFVKTNIPIGNVQINKADLSEIPRCECKPDQDNPCSNDSDCLNRMLMYE
CHPQTCPAAEKCQNQRFTKREYPNSEALKTPSRGWGLYTKVDVKKGQFVNEYVGDLVDED
ECRRRIKQAHEDNITNFYMLTLDKNRVIDAGPKGNLSRFMNHSCQPNCETQKWMVNGDVR
VGLFALNDISAGSELTFNYNLECLGNEKTVCACGAFNCSGFLGVRPKVSSIANANRVKDG
NKKKKRKKKIDIKKEHDDDCFRCEEGGELVMCDHNTCPKVYHLQCLNLTKPPTGKWLCPW
HHCDDCGKAAVKRCSKCPNSYCSKHIKGNIFDVEGTLYCHDHD
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatatgttgtgggggaaagttgggggtcatccatggtggccttgtatggtgtct
gaatgtccttatactttccagtttactaagctctctggtagtcgaatgaccaggatgtat
catgtacaatattttggtaatgaaggcgagcgaggttggattacggagtcctctaccatt
ccatttaaaggcctgaaggaattcttggatcatgccgacgaacagatccaaactgcgtct
aaaaaattaaaaccaaaagttgtacaatcatttaaaatccagccaacgcgtaaatgtgct
tgggacataggcgtagctcaagctacggaggcctttaactttgatatcaaagaaagacaa
gagaaatatacctttgtgtatgatttaaaacaaaactttaccacagtgaaatctaaagac
actcccggaactcctccaaaaaaacgtggacggaaacgaaaagttgaaagtgacgaaaca
tctccctcgtcagtggatgaacctaacacaccggtggaacagaattcaaaacgacagaag
ttagattccagagaagaggacaaatcagatgatagtctagtcaaagcgttatttacgcgc
cctaaaactgtgaaatacgaagcctcattcgatacgttttataataaacatgaggagagc
gtgttggatgagcatcctgattggtcaggggacgaggtccgagaacatctcagtcaacaa
tggagtattatgacagacaaacagaaggctagatataaaactaaatttacagtagattct
gatactccaagttcaccagctgatgaagataaaaagggtcagcagaatgtaaaccctaaa
tctacaggcactagaaaggttgaggaaccagaaaagcaacaaaaacagaaaaaatcagaa
aagaaagatacaccaaaacctccgaaagaatccacaaaaccacctaaatctaaatcgcgt
agatctgaatcagtgagctcgactgcgacgccagaggacgccacagaagatacagaatcg
tctgtgccagaaggaaaagagaagaaaaaatcgcggaaatctaaaaatttgttatcagtt
ccagccaatcatgattctgattcaggatctgaaaagtctgaacctagggtaatattacag
agtacgataaagtcaggagatggggagtacgaactagatatatttaaacttcacgctact
agtaacgctaaacgtgaaaatatctgtgttatatgtgaacaaccaggacaattattagaa
tgccaaggggcgtgtcagggtcacttccatgccagctgtttaaaagtctcagattatcag
gaagcagagtttaagtgtaatgaatgtgaaaccggtaatcatacatgttttggttgtaaa
gaagccagtcctgaaacaaggaaatgttctgtatcatcctgtggtaaattctatcatgaa
tcatgttttaagaaatatcctcagtcacgtatagaaggcaaatcatatttctgtcctctt
catacgtgtgctacctgtgcagcagataatcctaaaaatcctaaagccacaaaaggtcgt
ttattgaggtgtgtacggtgtccagtagcttaccatgctggtgattattgtatagcagct
ggagctatcaatctagcaggaaaccatattgtctgtagtaaacatttccaacccaataaa
actcagagacatcatgctcatgttaacgtcagctggtgttttcaatgtagtaaaggaggc
acgttactatgttgtgaatcatgtcctgctgcctaccatcctgaatgtttgaagttatct
ttccctgaaggaagttggtattgtcaggattgttcaagtggtaaaaaacctctctatgga
gacttgatctggattaaaataggcaattatagatggtggccgggagaaatttgtcatcct
cgaaatgttccattaaatatccaggagaaaacacatcaagttggagaatttccagtccgg
ttctttggttcacatgatttttactggacacatcaaggaagggtgtttctgtttcaagaa
ggcgataaaggcagtcgagatcagagtgaggctaaaggactcgctaaaatatttggaaaa
gaggctacagaagcttttaaaatatggcaggcagctaaagcaaataaagaacagttagag
aaagaaaataattctaaaaaaccagcaccttttaaatttgtcaagactaatataccaata
ggtaatgtacagattaataaagctgatttatcagagattccgaggtgtgaatgtaaacca
gatcaagataatccctgtagtaatgattcagattgtttaaatcgtatgttaatgtatgaa
tgtcatccacaaacctgtcctgcagccgagaaatgtcagaatcaacgttttacgaagcga
gaataccccaactcagaagccttgaagactccaagtagaggctggggactttatactaaa
gttgatgtcaaaaagggccagtttgtaaatgagtatgtaggagatctggtagatgaggat
gaatgtagaagaagaatcaaacaggctcatgaagataatatcactaatttctatatgtta
actcttgataaaaacagagtaatagatgcaggaccaaaagggaatttatctcgatttatg
aatcattcatgtcaaccgaactgtgagactcagaaatggatggtaaacggtgatgttaga
gttggtttgtttgctctcaatgatatctctgcaggttctgaattaacgttcaactataac
ctagaatgtcttggaaatgaaaaaacagtgtgtgcttgtggagcttttaactgtagtgga
tttttaggggttagacccaaggtaagctctatagcgaatgctaatagagtaaaagatggg
aacaagaaaaagaaacgtaaaaagaagatagatataaagaaagaacatgatgatgattgt
ttccgatgtgaagaagggggagaactagtgatgtgtgatcataacacgtgtcctaaagtt
tatcatctacaatgtttaaatcttactaaacctcctacaggtaaatggctgtgtccctgg
caccattgtgatgattgtggtaaagctgctgttaaacgatgttctaaatgtcccaattca
tattgttctaaacatatcaaaggcaatatatttgatgtagaaggaacattgtattgtcat
gaccatgat

DBGET integrated database retrieval system