KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_196777Help
Entry
LOTGIDRAFT_196777 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOTGIDRAFT_196777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lgi03036]
    LOTGIDRAFT_196777
   03400 DNA repair and recombination proteins [BR:lgi03400]
    LOTGIDRAFT_196777
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     LOTGIDRAFT_196777
Chromosome and associated proteins [BR:lgi03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    LOTGIDRAFT_196777
DNA repair and recombination proteins [BR:lgi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LOTGIDRAFT_196777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 20245211
NCBI-ProteinID: XP_009064975
JGI: 196777
UniProt: V4B746
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MPSPVFKKVLTWTPPKSPFNLIQESLFHDPWKLLIATIFLNKTTGTAAIPLLWKFFNRWP
TADSARNGSAEKMSKLMQPLGLHEKRAETIIRFSDEYLTKKWTYPNELHGIGKYGNDSYR
IFCVNEWRQVKPTDHKLNDYHDWLCKNEQELGI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctccggtttttaagaaagtcttaacatggacgcctccgaaatcaccatttaat
ttgattcaagagagtttgtttcatgatccgtggaagttattaatagctacaatatttcta
aataaaactacaggcacagctgctataccgttactatggaaatttttcaatcgttggcca
acagcggattcggccaggaatggatctgctgaaaaaatgtccaaattaatgcagccttta
ggacttcatgaaaaaagagcagaaaccattatacgattttcagatgaatacctgacaaag
aaatggacgtaccctaatgaactacatggcataggaaaatatgggaatgattcgtacaga
atcttctgtgttaatgaatggagacaggtgaagcctacagaccacaaactgaatgactat
catgattggttgtgtaaaaatgaacaggagttgggaatctga

DBGET integrated database retrieval system